


| Basic Information | |
|---|---|
| Family ID | F098122 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MATDTLASPATLSRTQTKVFKNFIDGEWVESSTGETFE |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.15 % |
| % of genes from short scaffolds (< 2000 bps) | 85.58 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.808 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.539 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.923 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.115 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.55% β-sheet: 21.21% Coil/Unstructured: 74.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF01432 | Peptidase_M3 | 6.73 |
| PF04773 | FecR | 5.77 |
| PF00857 | Isochorismatase | 5.77 |
| PF00557 | Peptidase_M24 | 2.88 |
| PF00005 | ABC_tran | 2.88 |
| PF12704 | MacB_PCD | 2.88 |
| PF05960 | DUF885 | 2.88 |
| PF13231 | PMT_2 | 2.88 |
| PF05016 | ParE_toxin | 1.92 |
| PF13411 | MerR_1 | 1.92 |
| PF00072 | Response_reg | 0.96 |
| PF02604 | PhdYeFM_antitox | 0.96 |
| PF05368 | NmrA | 0.96 |
| PF11746 | DUF3303 | 0.96 |
| PF03551 | PadR | 0.96 |
| PF03279 | Lip_A_acyltrans | 0.96 |
| PF13518 | HTH_28 | 0.96 |
| PF14559 | TPR_19 | 0.96 |
| PF12779 | WXXGXW | 0.96 |
| PF01578 | Cytochrom_C_asm | 0.96 |
| PF05195 | AMP_N | 0.96 |
| PF05872 | HerA_C | 0.96 |
| PF13649 | Methyltransf_25 | 0.96 |
| PF13290 | CHB_HEX_C_1 | 0.96 |
| PF04085 | MreC | 0.96 |
| PF07690 | MFS_1 | 0.96 |
| PF00171 | Aldedh | 0.96 |
| PF11185 | DUF2971 | 0.96 |
| PF01098 | FTSW_RODA_SPOVE | 0.96 |
| PF04185 | Phosphoesterase | 0.96 |
| PF01676 | Metalloenzyme | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 6.73 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 6.73 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 5.77 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 5.77 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 2.88 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.96 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.96 |
| COG0433 | Archaeal DNA helicase HerA or a related bacterial ATPase, contains HAS-barrel and ATPase domains | Replication, recombination and repair [L] | 0.96 |
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 0.96 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.96 |
| COG1560 | Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis) | Lipid transport and metabolism [I] | 0.96 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.96 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.96 |
| COG1792 | Cell shape-determining protein MreC | Cell cycle control, cell division, chromosome partitioning [D] | 0.96 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.96 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.96 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.96 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.96 |
| COG4261 | Predicted acyltransferase, LPLAT superfamily | General function prediction only [R] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.77 % |
| Unclassified | root | N/A | 19.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000579|AP72_2010_repI_A01DRAFT_1005351 | All Organisms → cellular organisms → Bacteria | 2303 | Open in IMG/M |
| 3300000955|JGI1027J12803_100904258 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300005468|Ga0070707_100404398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1325 | Open in IMG/M |
| 3300005538|Ga0070731_11123914 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005542|Ga0070732_10859981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 554 | Open in IMG/M |
| 3300005557|Ga0066704_10110301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1815 | Open in IMG/M |
| 3300005559|Ga0066700_11129929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 512 | Open in IMG/M |
| 3300005575|Ga0066702_10327110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300005614|Ga0068856_102134353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300005712|Ga0070764_10141604 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300005712|Ga0070764_10201373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1117 | Open in IMG/M |
| 3300005764|Ga0066903_106802186 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005841|Ga0068863_100048530 | All Organisms → cellular organisms → Bacteria | 4026 | Open in IMG/M |
| 3300005894|Ga0075270_1002114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2077 | Open in IMG/M |
| 3300005895|Ga0075277_1077734 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005921|Ga0070766_10217888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
| 3300005995|Ga0066790_10194033 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300006028|Ga0070717_11135466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300006034|Ga0066656_10475919 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300006163|Ga0070715_10390872 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → unclassified Methanoregulaceae → Methanoregulaceae archaeon PtaB.Bin056 | 770 | Open in IMG/M |
| 3300006175|Ga0070712_101933906 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Rhodothermus → Rhodothermus marinus | 516 | Open in IMG/M |
| 3300006176|Ga0070765_100456506 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300006358|Ga0068871_100622063 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300006854|Ga0075425_100002756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 17628 | Open in IMG/M |
| 3300006914|Ga0075436_101185802 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300009089|Ga0099828_10176634 | All Organisms → cellular organisms → Bacteria | 1899 | Open in IMG/M |
| 3300009759|Ga0116101_1204921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300010343|Ga0074044_10974669 | Not Available | 555 | Open in IMG/M |
| 3300010366|Ga0126379_11471768 | Not Available | 787 | Open in IMG/M |
| 3300010376|Ga0126381_102438903 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300010398|Ga0126383_11176584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300010937|Ga0137776_1657367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300011270|Ga0137391_11446119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 533 | Open in IMG/M |
| 3300012202|Ga0137363_10778830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300012362|Ga0137361_10760036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300012917|Ga0137395_11209664 | Not Available | 528 | Open in IMG/M |
| 3300012925|Ga0137419_10510406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 955 | Open in IMG/M |
| 3300012925|Ga0137419_10717399 | Not Available | 812 | Open in IMG/M |
| 3300013100|Ga0157373_10170787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus | 1530 | Open in IMG/M |
| 3300013307|Ga0157372_10255657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2034 | Open in IMG/M |
| 3300014495|Ga0182015_10241215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300015371|Ga0132258_10803565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2371 | Open in IMG/M |
| 3300015371|Ga0132258_10954743 | All Organisms → cellular organisms → Bacteria | 2166 | Open in IMG/M |
| 3300017966|Ga0187776_10870946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300017975|Ga0187782_11408176 | Not Available | 548 | Open in IMG/M |
| 3300018034|Ga0187863_10620790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300018038|Ga0187855_10619780 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300018042|Ga0187871_10310217 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300018044|Ga0187890_10214252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300018085|Ga0187772_10793618 | Not Available | 683 | Open in IMG/M |
| 3300019786|Ga0182025_1229255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1220 | Open in IMG/M |
| 3300020034|Ga0193753_10069558 | All Organisms → cellular organisms → Bacteria | 1825 | Open in IMG/M |
| 3300020582|Ga0210395_10460550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
| 3300020583|Ga0210401_10845471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300021178|Ga0210408_10471249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
| 3300021180|Ga0210396_10384007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
| 3300021404|Ga0210389_11501227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300021405|Ga0210387_10493849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300021405|Ga0210387_11022922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300021407|Ga0210383_11664743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300021474|Ga0210390_10037949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3936 | Open in IMG/M |
| 3300021474|Ga0210390_10126941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2141 | Open in IMG/M |
| 3300021475|Ga0210392_10183263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1452 | Open in IMG/M |
| 3300021560|Ga0126371_11115481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300021858|Ga0213852_1041115 | Not Available | 640 | Open in IMG/M |
| 3300021861|Ga0213853_10103773 | Not Available | 1222 | Open in IMG/M |
| 3300023030|Ga0224561_1023362 | Not Available | 543 | Open in IMG/M |
| 3300025612|Ga0208691_1048394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300025903|Ga0207680_11127996 | Not Available | 560 | Open in IMG/M |
| 3300025904|Ga0207647_10071634 | Not Available | 2091 | Open in IMG/M |
| 3300025928|Ga0207700_10787595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300025929|Ga0207664_10838666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300027559|Ga0209222_1077018 | Not Available | 643 | Open in IMG/M |
| 3300027701|Ga0209447_10024372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1694 | Open in IMG/M |
| 3300027767|Ga0209655_10203772 | Not Available | 650 | Open in IMG/M |
| 3300027842|Ga0209580_10255516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300027862|Ga0209701_10582311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 596 | Open in IMG/M |
| 3300027867|Ga0209167_10162744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300027874|Ga0209465_10059498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1839 | Open in IMG/M |
| 3300027884|Ga0209275_10060821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1845 | Open in IMG/M |
| 3300027895|Ga0209624_10723877 | Not Available | 656 | Open in IMG/M |
| 3300028807|Ga0307305_10457134 | Not Available | 574 | Open in IMG/M |
| 3300028906|Ga0308309_10990235 | Not Available | 729 | Open in IMG/M |
| 3300029943|Ga0311340_11364765 | Not Available | 562 | Open in IMG/M |
| 3300029951|Ga0311371_10377387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1944 | Open in IMG/M |
| 3300029955|Ga0311342_10505110 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300030057|Ga0302176_10289197 | Not Available | 658 | Open in IMG/M |
| 3300030518|Ga0302275_10113135 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
| 3300030617|Ga0311356_10197414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2058 | Open in IMG/M |
| 3300030618|Ga0311354_10072565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3918 | Open in IMG/M |
| 3300030991|Ga0073994_12298850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300031231|Ga0170824_125880827 | Not Available | 590 | Open in IMG/M |
| 3300031231|Ga0170824_126658655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300031234|Ga0302325_12687076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300031718|Ga0307474_10168827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1657 | Open in IMG/M |
| 3300031820|Ga0307473_10626654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300032174|Ga0307470_10961254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300032180|Ga0307471_101636095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300032180|Ga0307471_102752393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300032770|Ga0335085_10897746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300032783|Ga0335079_10002937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 19643 | Open in IMG/M |
| 3300032897|Ga0335071_10039293 | Not Available | 4683 | Open in IMG/M |
| 3300032955|Ga0335076_10071210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3424 | Open in IMG/M |
| 3300033158|Ga0335077_10998444 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.77% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.81% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.88% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.92% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.92% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.92% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.96% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.96% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.96% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005894 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_203 | Environmental | Open in IMG/M |
| 3300005895 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A01DRAFT_10053513 | 3300000579 | Forest Soil | MATDTLATPAGLSTSQTRVFKNFIDGQWVDSVTGDTFENR |
| JGI1027J12803_1009042581 | 3300000955 | Soil | MATDTVTSPEMMASGTTKVLKNFIDGEWVASSTGETFEDR |
| Ga0070707_1004043981 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MATETMTGPTILGSTTKTRVFKNFIDGEWVESSTGETFENCN |
| Ga0070731_111239142 | 3300005538 | Surface Soil | MATDTLASPATLGYNPTKVFKNFIDGEWVESSTGETFE |
| Ga0070732_108599812 | 3300005542 | Surface Soil | MATDTLASPASLSESQTRVFNNYIDGEWVESSTGATFEN |
| Ga0066704_101103013 | 3300005557 | Soil | MATETMTGPTILGSTTKTRVFKNFIDGEWVESSTGETF |
| Ga0066700_111299292 | 3300005559 | Soil | MATETMTGPTILGSTTKTKVFKNFIDGEWVESSTGETFE |
| Ga0066702_103271103 | 3300005575 | Soil | MATDTLASPASLSESQTRVFKNYIDGEWVESSTGE |
| Ga0068856_1021343531 | 3300005614 | Corn Rhizosphere | MATDTLATPASLSESQTRVFKNYIDGEWVESSTGET |
| Ga0070764_101416042 | 3300005712 | Soil | MATDTLASPTILGNSQPTKVYKNFIDGEWVESSSGQ |
| Ga0070764_102013731 | 3300005712 | Soil | MATDTLATPATLSDAKTRVFKNFIDGEWVESSTGETF |
| Ga0066903_1068021861 | 3300005764 | Tropical Forest Soil | MATDTLASPPSALSYGPTRVFKNFIDGEWVDDSTGETFEN |
| Ga0068863_1000485301 | 3300005841 | Switchgrass Rhizosphere | MATTTLTDPPAFSSASKTKVFKNFINGEWAESSSGQTFENISPAD |
| Ga0075270_10021142 | 3300005894 | Rice Paddy Soil | MATDTLAASIGTGSSARVYKNFIDGEWVESRTGETF* |
| Ga0075277_10777342 | 3300005895 | Rice Paddy Soil | MATDTLATPASLSASQTRVFKNYIDGEWVESSTGE |
| Ga0070766_102178883 | 3300005921 | Soil | MATDTLASPATLSYGKTKVFKNFIDGEWIEASTGE |
| Ga0066790_101940331 | 3300005995 | Soil | MATDTLATPAITGSGKTKVYKNLIDGEWVESKNGET |
| Ga0070717_111354662 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MATDTLATPASLSESQTRVFKNYIDGEWVESSTGE |
| Ga0066656_104759192 | 3300006034 | Soil | MATETMTGPTILGSATKTKVFKNFIDGEWVESSTGETFENC |
| Ga0070715_103908722 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MATDTVTSAPMLGSSTPTRVFKNFIDGEWVESRTGETFED |
| Ga0070712_1019339061 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MATDTVTSPELMASGNTKVLKNFIDGEWVASSTGETFEDRNP |
| Ga0070765_1004565063 | 3300006176 | Soil | MATDTLTSPATLSYGKTQVFKNFIDGEWVEASTGETFENR |
| Ga0068871_1006220631 | 3300006358 | Miscanthus Rhizosphere | MATDTMAAATISGGTGTKVYKNLIDGEWVESSTGE |
| Ga0075425_10000275613 | 3300006854 | Populus Rhizosphere | MATDTLTASIGTSSSARVYKNFIDGEWVESRTGDMFEDRNP |
| Ga0075436_1011858023 | 3300006914 | Populus Rhizosphere | MATDTLTSPPALGSSTAPKVYKNFIDGEWVESSTGE |
| Ga0099828_101766341 | 3300009089 | Vadose Zone Soil | MATDTLAAPAIIGSRTTTKVYKNFMDGEWVESSTGET |
| Ga0116101_12049212 | 3300009759 | Peatland | MATDTLASPAHLSHTSTKVLKNFIDGEWVESSTGETF |
| Ga0074044_109746692 | 3300010343 | Bog Forest Soil | MATDTLASPATLSHKPTKIMKNFIDGEWVDSSTGE |
| Ga0126379_114717682 | 3300010366 | Tropical Forest Soil | MATETVAHPAITSTGNTRVFKNFIDGEWVASTTGE |
| Ga0126381_1024389032 | 3300010376 | Tropical Forest Soil | MATDTLATPAGLSDSQARVFKNFIDGEWVDSSTGDTFE |
| Ga0126383_111765841 | 3300010398 | Tropical Forest Soil | MATETVTSPELMASGKTRVFQNFIDGEWVASSTGETFEN |
| Ga0137776_16573671 | 3300010937 | Sediment | MATDTVTSPATLSYGTTKVFKNFIDGEWVESSTGET |
| Ga0137391_114461192 | 3300011270 | Vadose Zone Soil | MATDTLATPAIIGSRTTTKVYKNFIDGEWVESSTGETFE |
| Ga0137363_107788302 | 3300012202 | Vadose Zone Soil | MATDTMTSPAVMSSGNTRVYKNYIAGEWVESSTGETF |
| Ga0137361_107600361 | 3300012362 | Vadose Zone Soil | MATDTVTSPAVLSSGNTKVYKNYIAGEWVESSTGETF |
| Ga0137395_112096641 | 3300012917 | Vadose Zone Soil | MATHTLATPPVIGSSNPTKVYLNFIDGEWVESSTGETFEN |
| Ga0137419_105104061 | 3300012925 | Vadose Zone Soil | MATDILTGPTILGSTTRTKIFKNFIDGEWVESSTGETFEN |
| Ga0137419_107173992 | 3300012925 | Vadose Zone Soil | MATETLPTPATIGNTNPTKVYKNFIDGEWVESSTGETFE |
| Ga0157373_101707873 | 3300013100 | Corn Rhizosphere | MATDTLTSPPALGSSTAPKVYKNFIDGEWVESSTGETFE |
| Ga0157372_102556573 | 3300013307 | Corn Rhizosphere | MSMATDTLTASIGTGSSARVYKNFIDGEWVQSRTGEMFED |
| Ga0182015_102412151 | 3300014495 | Palsa | MATDTLTSPPVLGTGSKTKVYRNFIDGDWVESSTG |
| Ga0132258_108035651 | 3300015371 | Arabidopsis Rhizosphere | MATDTLASPATLNYGQTKVFKNLIDGEWVDASTGATF |
| Ga0132258_109547434 | 3300015371 | Arabidopsis Rhizosphere | MATDILAAPAGLSSTQTRVFKNFIDGEWVEASTGE |
| Ga0187776_108709462 | 3300017966 | Tropical Peatland | MATDTLASPATIGSSTKAKVYKNFIDGEWVEASTGETFE |
| Ga0187782_114081761 | 3300017975 | Tropical Peatland | VATDTFATPAQLSTSQTRVFKNFIDGEWVEASTGETFENR |
| Ga0187863_106207902 | 3300018034 | Peatland | MATDTLAAPATLSSSQAKVYKNFIDGEWVESSTGETF |
| Ga0187855_106197801 | 3300018038 | Peatland | MAIETLASPTTLGVSNPTRIIKNFIDGEWVESSTGETF |
| Ga0187871_103102172 | 3300018042 | Peatland | MATDTLPTPATLSHQPTKIFKNFIDGEWVDSSTGETFE |
| Ga0187890_102142521 | 3300018044 | Peatland | MATDTLAAPATLSSSQAKVYKNFIDGEWVESSTGETFE |
| Ga0187772_107936181 | 3300018085 | Tropical Peatland | MATDTLATPAAQNYGGTKVFKNFIDGEWVEASTGETFEN |
| Ga0182025_12292552 | 3300019786 | Permafrost | MATDTVITPATPAYGKTKVFKNFIDGEWVEASHGGDI |
| Ga0193753_100695581 | 3300020034 | Soil | MATDTLATPAIAGSGNTKVYKNFIDGEWVDSESGETFEN |
| Ga0210395_104605501 | 3300020582 | Soil | MATDTLAAPAILSDSKTKVFKNFIDGEWVESSTGQTFEN |
| Ga0210401_108454712 | 3300020583 | Soil | MATETVGSPAIMASGNTKVYKNFINGEWVESSTGETF |
| Ga0210408_104712491 | 3300021178 | Soil | MATETVGSPAIMASGNTKVYKNFINGEWVESSTGETFEDR |
| Ga0210396_103840071 | 3300021180 | Soil | MATDTLATPATLSDAKTRVFKNFIDGEWVESSTGETFENR |
| Ga0210389_115012272 | 3300021404 | Soil | MATDTLASPTILGNSQPTKVYKNFIDGEWVKSSSGQTFED |
| Ga0210387_104938491 | 3300021405 | Soil | MATDTLTSPAALSYGKTKVFKNFIDGEWVEASTGETFEN |
| Ga0210387_110229221 | 3300021405 | Soil | MATNTLPTPAAVNYGGTKVFKNFIDGEWVESSTGQT |
| Ga0210383_116647432 | 3300021407 | Soil | MATDTLAAPATLSNSQTKVFKNFIDGEWVESSTGE |
| Ga0210390_100379491 | 3300021474 | Soil | MATDTVAKVAVASAGNTKIYKNFIDGEWVESTTGETF |
| Ga0210390_101269413 | 3300021474 | Soil | MATDTLTTPPTLSYGKTKVFKNFIDGEWVEASTGQTFEN |
| Ga0210392_101832633 | 3300021475 | Soil | MATDTLTSPVALNYGKTKVFKNFIDGEWVESSTGETF |
| Ga0126371_111154812 | 3300021560 | Tropical Forest Soil | MATDTFRTPAQLSESQVRVFKNFIDGEWVEASTGETF |
| Ga0213852_10411152 | 3300021858 | Watersheds | MATDTLATPADLSSTQARVFKNFIDGEWVESSTGE |
| Ga0213853_101037731 | 3300021861 | Watersheds | MATDTLATPATLSNSQTRVFKNFIDGEWVESSTGETF |
| Ga0224561_10233622 | 3300023030 | Soil | MATDTLTSPAILGYNPTKVTKNFIDGEWVESVTGETFEDRNP |
| Ga0208691_10483941 | 3300025612 | Peatland | MATDTLTSPVTLSYGKTKVFKNFIDGEWVEASTGE |
| Ga0207680_111279962 | 3300025903 | Switchgrass Rhizosphere | MATDTMAAATISGGTGTKVYKNLIDGEWVESSTGETFE |
| Ga0207647_100716342 | 3300025904 | Corn Rhizosphere | MATDTMAAATISGGTGTKVYKNLIDGEWVESSTGETFEN |
| Ga0207700_107875951 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MATDTLATPASLSESQTRVFKNYIDGEWVESSTGETFENRN |
| Ga0207664_108386662 | 3300025929 | Agricultural Soil | MATETFATPASLSESQARVFKNFIDGDWVDSSTGET |
| Ga0209222_10770181 | 3300027559 | Forest Soil | MATDTLASPATLGYNPTKVYKNFIDGEWVESTTGETF |
| Ga0209447_100243722 | 3300027701 | Bog Forest Soil | MATKTLASPAIVGYNPTKVFKNFIDGEWVESSTGETFEDR |
| Ga0209655_102037721 | 3300027767 | Bog Forest Soil | MATDTLTSPAALSHTPTKILKNFIDGEWVESSTGETFEDR |
| Ga0209580_102555162 | 3300027842 | Surface Soil | MATETMTTPPPALGYGQTRVFKNFIDGEWVESSTGLTFENRN |
| Ga0209701_105823111 | 3300027862 | Vadose Zone Soil | MATDTLATPAIIGSRTTTKVYKNFIDGEWVESSTGETFENL |
| Ga0209167_101627441 | 3300027867 | Surface Soil | MATDTLATPATLSDAKTRVFKNFIDGEWVEFSTGETFE |
| Ga0209465_100594983 | 3300027874 | Tropical Forest Soil | MATDTLATPAGLSTSQTRVFKNFIDGQWVDSVTGDTF |
| Ga0209275_100608212 | 3300027884 | Soil | MATDTLAAPATLSNSQTKVFKNFIDGEWVESSTGETFE |
| Ga0209624_107238771 | 3300027895 | Forest Soil | MATDTFIAPSALSPTQTKVFKNFIDGEWVASSTGETFEN |
| Ga0307305_104571342 | 3300028807 | Soil | MATDTLASPAVIGSNTKTKTYKNFIDGEWVESSTGQT |
| Ga0308309_109902352 | 3300028906 | Soil | MATDTLTSPAMLGTSTAPKVYKNFIDGEWVESSTGESF |
| Ga0311340_113647651 | 3300029943 | Palsa | MATDTLASPAILGYSPTKVFKNFIDGEWVEASTRETF |
| Ga0311371_103773871 | 3300029951 | Palsa | MATDTLASPATLSHTPTKVLKNFIDGEWVESSTGETF |
| Ga0311342_105051102 | 3300029955 | Bog | MATLTSPATLGSTHPTKVYKNFIDGEWVESSTGETF |
| Ga0302176_102891971 | 3300030057 | Palsa | MATDTFTAPTPATLSDTQTKVFKNFIDGEWVDSVTGETFEN |
| Ga0302275_101131354 | 3300030518 | Bog | MAADTLASPATLGYNKTKVLKNFVDGEWVESSTGET |
| Ga0311356_101974141 | 3300030617 | Palsa | MATDTLATPAAINYGGTKVFKNFIDGEWVESSTGETFENR |
| Ga0311354_100725654 | 3300030618 | Palsa | MATDTFTAPTPATLSDTQTKVFKNFIDGEWVDSVTGET |
| Ga0073994_122988501 | 3300030991 | Soil | MATHTLATPPVIGSSSPTKVYQNFIDGEWVESSTGET |
| Ga0170824_1258808272 | 3300031231 | Forest Soil | MATDTLASPATLSHSQTKVFKNFIDGEWVESTTGETFENR |
| Ga0170824_1266586552 | 3300031231 | Forest Soil | MATDTLSSPVLDGSSSHPIVYKNFIDGEWVESSTGQTF |
| Ga0302325_126870761 | 3300031234 | Palsa | MATDTLAAPATLSNSQAKVYKNFIDGEWVESSTGETFE |
| Ga0307474_101688271 | 3300031718 | Hardwood Forest Soil | MATDTLASPATLSNTQTKVFKNFIDGEWVESSTGE |
| Ga0307473_106266542 | 3300031820 | Hardwood Forest Soil | MATDTLAGPAMLGTSTKARVYKNFIDGEWVESSTGETFENR |
| Ga0307470_109612542 | 3300032174 | Hardwood Forest Soil | MATDAMPTPATLSDTQARVGENFIDGEWVDSRTPMLFSVN |
| Ga0307471_1016360952 | 3300032180 | Hardwood Forest Soil | MATDAMPTPATLSDTQARVGENFIDGEWMDSRTPMLFSVN |
| Ga0307471_1027523932 | 3300032180 | Hardwood Forest Soil | MATDTLASPATLSRTQTKVFKNFIDGEWVESSTGETFE |
| Ga0335085_108977461 | 3300032770 | Soil | MATDTLASPATLNYGKTKVFKNFIDGEWVEASTGETF |
| Ga0335079_1000293715 | 3300032783 | Soil | MATDTLASPAMLGSSSKSKVYKNFIDGEWVEASTG |
| Ga0335071_100392931 | 3300032897 | Soil | MATDTLATPATLSTSQTRVFKNFINGEWVESSTGDTFEN |
| Ga0335076_100712101 | 3300032955 | Soil | MATDTLAAPATLSSGNTKVFKNFIDGEWVEASTGET |
| Ga0335077_109984441 | 3300033158 | Soil | MATDTLATPAKLSNSQTRVFKNFIDGEWVESSTGQT |
| ⦗Top⦘ |