


| Basic Information | |
|---|---|
| Family ID | F098113 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VLGYLAISRGVIIEPPAFIANAITAVMERIAQRTSALMGQTP |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.46 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.769 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.269 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.077 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.077 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.14% β-sheet: 0.00% Coil/Unstructured: 52.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF03739 | LptF_LptG | 91.35 |
| PF04453 | LptD | 2.88 |
| PF00398 | RrnaAD | 0.96 |
| PF13561 | adh_short_C2 | 0.96 |
| PF03968 | LptD_N | 0.96 |
| PF00625 | Guanylate_kin | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0795 | Lipopolysaccharide export LptBFGC system, permease protein LptF | Cell wall/membrane/envelope biogenesis [M] | 91.35 |
| COG1452 | LPS assembly outer membrane protein LptD (organic solvent tolerance protein OstA) | Cell wall/membrane/envelope biogenesis [M] | 2.88 |
| COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG0194 | Guanylate kinase | Nucleotide transport and metabolism [F] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.77 % |
| Unclassified | root | N/A | 19.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig108657 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 2170459016|G1P06HT02HSI1X | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1042714 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300000858|JGI10213J12805_10940897 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1044279 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300000956|JGI10216J12902_103662580 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300003659|JGI25404J52841_10121984 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005162|Ga0066814_10108637 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005172|Ga0066683_10330695 | Not Available | 947 | Open in IMG/M |
| 3300005175|Ga0066673_10344230 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300005329|Ga0070683_100555645 | Not Available | 1098 | Open in IMG/M |
| 3300005340|Ga0070689_101083209 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300005446|Ga0066686_10624114 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005455|Ga0070663_100172681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1672 | Open in IMG/M |
| 3300005466|Ga0070685_10339109 | Not Available | 1024 | Open in IMG/M |
| 3300005535|Ga0070684_100939591 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300005566|Ga0066693_10255624 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300005841|Ga0068863_100017674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 6828 | Open in IMG/M |
| 3300006032|Ga0066696_10662643 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300006163|Ga0070715_10524880 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300006173|Ga0070716_100793178 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300006175|Ga0070712_100332301 | Not Available | 1239 | Open in IMG/M |
| 3300006844|Ga0075428_102169099 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300006852|Ga0075433_11226204 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300009012|Ga0066710_100079757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4260 | Open in IMG/M |
| 3300009090|Ga0099827_10179937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 1748 | Open in IMG/M |
| 3300009094|Ga0111539_12496054 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300009098|Ga0105245_12380229 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300009100|Ga0075418_12794237 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300010036|Ga0126305_10284164 | Not Available | 1071 | Open in IMG/M |
| 3300010043|Ga0126380_10095862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1765 | Open in IMG/M |
| 3300010043|Ga0126380_11152715 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300010301|Ga0134070_10102151 | Not Available | 1000 | Open in IMG/M |
| 3300010336|Ga0134071_10734761 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300010360|Ga0126372_12813300 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300010362|Ga0126377_13296999 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300010371|Ga0134125_12658113 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300010376|Ga0126381_100373619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1978 | Open in IMG/M |
| 3300010397|Ga0134124_12533307 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010397|Ga0134124_13021073 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010868|Ga0124844_1082081 | Not Available | 1207 | Open in IMG/M |
| 3300012199|Ga0137383_10189108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1509 | Open in IMG/M |
| 3300012582|Ga0137358_10000619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 17051 | Open in IMG/M |
| 3300012683|Ga0137398_10155571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1486 | Open in IMG/M |
| 3300012944|Ga0137410_10877897 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300012948|Ga0126375_10162325 | Not Available | 1423 | Open in IMG/M |
| 3300012951|Ga0164300_10034840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1882 | Open in IMG/M |
| 3300012951|Ga0164300_10171490 | Not Available | 1037 | Open in IMG/M |
| 3300012960|Ga0164301_11227271 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300013296|Ga0157374_12378691 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300015357|Ga0134072_10442206 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300015373|Ga0132257_101271602 | Not Available | 933 | Open in IMG/M |
| 3300016319|Ga0182033_11616380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 586 | Open in IMG/M |
| 3300016422|Ga0182039_11660305 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300018051|Ga0184620_10008273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2280 | Open in IMG/M |
| 3300018433|Ga0066667_12268224 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300018465|Ga0190269_10670224 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300021168|Ga0210406_11205533 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300021178|Ga0210408_11072010 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300021344|Ga0193719_10054789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1729 | Open in IMG/M |
| 3300021475|Ga0210392_10707222 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300025903|Ga0207680_10178880 | Not Available | 1433 | Open in IMG/M |
| 3300025937|Ga0207669_11395948 | Not Available | 596 | Open in IMG/M |
| 3300025939|Ga0207665_11210346 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300025944|Ga0207661_10573021 | Not Available | 1035 | Open in IMG/M |
| 3300025949|Ga0207667_10607147 | Not Available | 1103 | Open in IMG/M |
| 3300025986|Ga0207658_10789952 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300026067|Ga0207678_11265854 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300026121|Ga0207683_10132551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2242 | Open in IMG/M |
| 3300026277|Ga0209350_1014347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2503 | Open in IMG/M |
| 3300026300|Ga0209027_1078032 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300026361|Ga0257176_1033547 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300026552|Ga0209577_10097319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2391 | Open in IMG/M |
| 3300027061|Ga0209729_1009703 | Not Available | 1078 | Open in IMG/M |
| 3300027061|Ga0209729_1055504 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300027071|Ga0209214_1050727 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300027383|Ga0209213_1087014 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300027875|Ga0209283_10025753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3641 | Open in IMG/M |
| 3300027909|Ga0209382_12279876 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300028720|Ga0307317_10345858 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300028784|Ga0307282_10646293 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300028791|Ga0307290_10002390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 6027 | Open in IMG/M |
| 3300028876|Ga0307286_10086033 | Not Available | 1094 | Open in IMG/M |
| 3300031094|Ga0308199_1003735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1925 | Open in IMG/M |
| 3300031199|Ga0307495_10173406 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300031200|Ga0307496_10047952 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300031543|Ga0318516_10279269 | Not Available | 965 | Open in IMG/M |
| 3300031546|Ga0318538_10367325 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300031640|Ga0318555_10410602 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300031682|Ga0318560_10126575 | Not Available | 1340 | Open in IMG/M |
| 3300031716|Ga0310813_10026391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4047 | Open in IMG/M |
| 3300031724|Ga0318500_10187626 | Not Available | 986 | Open in IMG/M |
| 3300031724|Ga0318500_10484957 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031765|Ga0318554_10746345 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031771|Ga0318546_11040257 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300031846|Ga0318512_10144048 | Not Available | 1146 | Open in IMG/M |
| 3300031880|Ga0318544_10401992 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300031897|Ga0318520_10002910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 6348 | Open in IMG/M |
| 3300031912|Ga0306921_11602345 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300031945|Ga0310913_10085473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2111 | Open in IMG/M |
| 3300031947|Ga0310909_10664618 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300032035|Ga0310911_10405746 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300032094|Ga0318540_10562724 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300032261|Ga0306920_102000112 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.88% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.92% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031200 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_10525350 | 2124908045 | Soil | MAAFVLGYIAISRGVIIEPPAFIANAITRVMERITQRTGALMGQAP |
| 2ZMR_00681440 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | LMAAFVLGYIAISRGVIIEPPAFIANAITAVMERVARRTNALMGQAP |
| AP72_2010_repI_A01DRAFT_10427142 | 3300000579 | Forest Soil | ALMTTFVLGYIAISRGVIIEPPVFIANAITRVMERMTQRTNALMGQTS* |
| JGI10213J12805_109408972 | 3300000858 | Soil | VVGYFTISRGVIIEPPAFLANAITTLIERVTQRTNALIGQAP* |
| AP72_2010_repI_A001DRAFT_10442792 | 3300000893 | Forest Soil | VLPYLALMTTFVLGYIAISRGVIIEPPVFIANAITRVMERMTQRTNALMGQTS* |
| JGI10216J12902_1036625801 | 3300000956 | Soil | VLPYLALIAAFVLGYLAISRGIIIEPPAFLTNSITALIERITQRTNALMGQAS* |
| JGI25404J52841_101219841 | 3300003659 | Tabebuia Heterophylla Rhizosphere | PLALLLPYLALMATFVLGYIAISRGVIIEPPVFIANAITRVMERMTQRTNALMGQTP* |
| Ga0066814_101086372 | 3300005162 | Soil | AAFVLGYIAISRGVIIEPPAFIANAITAVMERVARRTNALMGQAP* |
| Ga0066683_103306952 | 3300005172 | Soil | GYIAISRGVIIEPPAFIANAITRVMERLTQRTNALMGQAP* |
| Ga0066673_103442301 | 3300005175 | Soil | GYIAISRGVIIEPPVFMANAITRLMERLAQRTGALMGQAP* |
| Ga0070683_1005556451 | 3300005329 | Corn Rhizosphere | FVLGYLAISRGVIIEPPAFVANAITAIMERIAQRTSALMGQTP* |
| Ga0070689_1010832092 | 3300005340 | Switchgrass Rhizosphere | SFVLGYLAISRGVIIEPPAFIANAITAIMERVAQRTSALMGQTP* |
| Ga0066686_106241142 | 3300005446 | Soil | VALLLPYLALVTTFVLGYIAISRGVIIEPPVFMANAITRLMERLAQRTGALMGQAP* |
| Ga0070663_1001726813 | 3300005455 | Corn Rhizosphere | ALIVSFVLGYLAISRGVIIEPPAFVANAITAIMERIAQRTSALMGQTP* |
| Ga0070685_103391092 | 3300005466 | Switchgrass Rhizosphere | YFAISRGVIIEPPAFIAQSITALMERLAQRTGTLMGQSP* |
| Ga0070684_1009395911 | 3300005535 | Corn Rhizosphere | SFVLGYLAISRGVIIEPPAFIANAITAIMERIAQRASALMGQPS* |
| Ga0066693_102556241 | 3300005566 | Soil | YIAISRGVIIEPPVFIANAITRVMERMTQRTNALMGQTP* |
| Ga0068863_1000176741 | 3300005841 | Switchgrass Rhizosphere | ALIVSFVLGYLAISRGVIIEPPAFIANAITAIMERIAQRASALMGQPS* |
| Ga0066696_106626432 | 3300006032 | Soil | ALLLPYLALMTTFVLGYIAISRGVIIEPPVFIANAITRVMERMTQRTNALMGQTP* |
| Ga0070715_105248801 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AISRGVIIEPPAFIANAITAIMERIAQRASALMGQPS* |
| Ga0070716_1007931781 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RGVIIEPPAFIANAITAVMERVARRTNALMGQAP* |
| Ga0070712_1003323011 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LGYIAISRGVIIEPPAFIANAITAVMERVARRTNALMGQAP* |
| Ga0075428_1021690991 | 3300006844 | Populus Rhizosphere | YLALTATFVLGYLAISRGVIIEPPAFIANSITAIMERITQRANALMGQPS* |
| Ga0075433_112262041 | 3300006852 | Populus Rhizosphere | GYLAISRGVIIEPPAFVANSITAIMERITQRANALMGQPS* |
| Ga0066710_1000797575 | 3300009012 | Grasslands Soil | ALIATFVLGYIAISRGVIIEPPAFIANAITRVMERLTQRTNALMGQAP |
| Ga0099827_101799373 | 3300009090 | Vadose Zone Soil | VLGYFAISRGVIIEPPAFIANAITAISERIAQRTGAMMGQAP* |
| Ga0111539_124960541 | 3300009094 | Populus Rhizosphere | YFTISRGVIIEPPAFLANAITTLIERVTQRTNALIGQAP* |
| Ga0105245_123802292 | 3300009098 | Miscanthus Rhizosphere | IVSFVLGYLAISRGVIIEPPAFVANAITAIMERIAQRTSALMGQTP* |
| Ga0075418_127942371 | 3300009100 | Populus Rhizosphere | ALLLPYLALMATFVLGYFAISRGVIIEPPVFIANAITRVMERVTQRTNALMGQTS* |
| Ga0126305_102841642 | 3300010036 | Serpentine Soil | VLGYLAISRGVIIEPPAFIANAITAIMERVAQRTSALMGQTP* |
| Ga0126380_100958623 | 3300010043 | Tropical Forest Soil | ATAFVLGYFTISRGVIIEPPAFITNAVTALTERMAQRSNALMGQSP* |
| Ga0126380_111527151 | 3300010043 | Tropical Forest Soil | IATFVLGYYAISRGLIIEPPVFVTNLVAAITERLAQRANALMGQAP* |
| Ga0134070_101021511 | 3300010301 | Grasslands Soil | LVTTFVLGYIAISRGVIIEPPVFMANAITRLMERLAQRTGALMGQAP* |
| Ga0134071_107347611 | 3300010336 | Grasslands Soil | PYLGLIAAFVLGYFAISRGVIIEPPAFIANTITAVMERIAQRANVLMGQAP* |
| Ga0126372_128133002 | 3300010360 | Tropical Forest Soil | YIAISRGVIIEPPAFIANAITAVMERVARRTNALMGQAP* |
| Ga0126377_132969991 | 3300010362 | Tropical Forest Soil | RGVIIEPPAFISNAITRVTERLTQRTTALMGQTP* |
| Ga0134125_126581132 | 3300010371 | Terrestrial Soil | PYIALIVSFVLGYLAISRGVIIEPPAFVANAITAIMERIAQRTSALMGQTP* |
| Ga0126381_1003736193 | 3300010376 | Tropical Forest Soil | VHTPIALLLPYLALIATFVLGYIAISRGVIIEPPVFIANAITRVMEHLTQRTNALMGQTP |
| Ga0134124_125333072 | 3300010397 | Terrestrial Soil | YLAISRGVIIEPPAFIANAITAIMERIAQRTSALMGQTP* |
| Ga0134124_130210732 | 3300010397 | Terrestrial Soil | LAISRGVIIEPPAFIANAITAIMERIAQRASALMGQPS* |
| Ga0124844_10820812 | 3300010868 | Tropical Forest Soil | YLALMAAFVLGYIAISRGVIIEPPAFIANAITAVMERVARRTNALMGQAP* |
| Ga0137383_101891081 | 3300012199 | Vadose Zone Soil | PYLALVTTFVLGYIAISRGVIIEPPVFMANAITRLMERLAQRTGALMGQAP* |
| Ga0137358_1000061917 | 3300012582 | Vadose Zone Soil | LGYIAISRGVIIEPPVFIANAMTRLMERLAQRTGALMGQAP* |
| Ga0137398_101555713 | 3300012683 | Vadose Zone Soil | ALMSAFVLGYIAISRGVIIEPPAFIANAITAVMERVARRTNALMGQAP* |
| Ga0137410_108778971 | 3300012944 | Vadose Zone Soil | MSRGVIIEPPTFVTNAITAVMERIAQRTGALTGQTP* |
| Ga0126375_101623251 | 3300012948 | Tropical Forest Soil | ISRGVIIEPPAFIANAITRVMERLTQRATALMGQTP* |
| Ga0164300_100348401 | 3300012951 | Soil | TPIALLLPYLALMATFVLGYFAISRGVIIEPPVFIANAITRVMERVTQRTNALMGQTS* |
| Ga0164300_101714902 | 3300012951 | Soil | ALIVSFVLGYLAISRGVIIEPPAFVANAITANMERIAQRTSALMGQTP* |
| Ga0164301_112272712 | 3300012960 | Soil | GYIAISRGVIIEPPAFIANAITAVMERVARRTNALMGQAP* |
| Ga0157374_123786912 | 3300013296 | Miscanthus Rhizosphere | IVSFVLGYLAISRGVIIEPPAFIAQSITALMERLAQRTGTLMGQSP* |
| Ga0134072_104422061 | 3300015357 | Grasslands Soil | TIAGVHTPIALLLPYLALMTTFVLGYIAISRGVIIEPPVFIANAITRVMERMTQRTNALMGQTP* |
| Ga0132257_1012716022 | 3300015373 | Arabidopsis Rhizosphere | YIGLIVSFVLGYLAISRGVIIEPPAFIANAITAIMERIAQRASALMGQPS* |
| Ga0182033_116163802 | 3300016319 | Soil | IVSRGIIIEPPAFVANAIATAMERIARYTPGLVGQSP |
| Ga0182039_116603052 | 3300016422 | Soil | LLLPYAGMIAAFVLGYLAISRGVIIEPPAFVANLIAAVMERLAQRTNAMAGQTP |
| Ga0184620_100082733 | 3300018051 | Groundwater Sediment | FVLGYLAISRGVIIEPPAFIANAITALIERIAQRTSALMGQTP |
| Ga0066667_122682241 | 3300018433 | Grasslands Soil | FVLGYLAISRGIIIEPPAFLTNSITALMERITQCTNALMGHAS |
| Ga0190269_106702242 | 3300018465 | Soil | GYLAISRGVIIEPPAFIANAITAIMERVAQRTSALMGQTP |
| Ga0210406_112055331 | 3300021168 | Soil | YLALMATFVLGYIAISRGVIIEPPVFIANAITRVMERATQRTNALMGQAS |
| Ga0210408_110720102 | 3300021178 | Soil | ISRGVIIEPPVFIANAITRVMERITQRTNALMGQTS |
| Ga0193719_100547891 | 3300021344 | Soil | SRGVIIEPPAFIANAITALIERIAQRTSALMGQTP |
| Ga0210392_107072222 | 3300021475 | Soil | LLLPYLALMATFVLGYFAISRGVIIEPPVFIANAITRVMERVTQRTNALMGQTS |
| Ga0207680_101788803 | 3300025903 | Switchgrass Rhizosphere | IALIVSFVLGYLAISRGVIIEPPAFIANAITAIMERIAQRARALMGQPS |
| Ga0207669_113959482 | 3300025937 | Miscanthus Rhizosphere | MATFVLGYFAISRGVIIEPPVFIANAITRVMERITQRTNALMGQTS |
| Ga0207665_112103462 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MATFVLGYIAISRGVIIEPPVFIANAITRVMERVTQRTNALMGQTS |
| Ga0207661_105730211 | 3300025944 | Corn Rhizosphere | FVLGYLAISRGVIIEPPAFVANAITAIMERIAQRTSALMGQTP |
| Ga0207667_106071471 | 3300025949 | Corn Rhizosphere | ISRGVIIEPPAFIANAITAIMERIAQRASALMGQPS |
| Ga0207658_107899522 | 3300025986 | Switchgrass Rhizosphere | AISRGVIIEPPAFVANAITAIMERIAQRTSALMGQTP |
| Ga0207678_112658542 | 3300026067 | Corn Rhizosphere | ALIVSFVLGYLAISRGVIIEPPAFVANAITAIMERIAQRTSALMGQTP |
| Ga0207683_101325513 | 3300026121 | Miscanthus Rhizosphere | FVLGYLAISRGVIIEPPAFIANAITAIMERIAQRASALMGQPS |
| Ga0209350_10143473 | 3300026277 | Grasslands Soil | AISRGVIIEPPAFIANAITRVMERLTQRTNALMGQAP |
| Ga0209027_10780321 | 3300026300 | Grasslands Soil | ALLLPYLALMATFVLGYFAISRGVIIEPPVFIANAITRVMERITQRTNALMGQTS |
| Ga0257176_10335471 | 3300026361 | Soil | VLGYIAISRGVIIEPPAFIANAITAVMERVARRTNALMGQAP |
| Ga0209577_100973191 | 3300026552 | Soil | GVHTPIALLLPYLALMTTFVLGYIAISRGVIIEPPVFIANAITRVMERMTQRTNALMGQT |
| Ga0209729_10097031 | 3300027061 | Forest Soil | YLALMAAFVLGYIAISRGVIIEPPAFIANAITAVMERVARRTNALMGQAP |
| Ga0209729_10555041 | 3300027061 | Forest Soil | PYLALMATFVLGYFAISRGVIIEPPVFIANAITRVMERVTQRTNALMGQTS |
| Ga0209214_10507271 | 3300027071 | Forest Soil | FVLGYIAISRGVIIEPPAFIANAITAVMERVARRTNALMGQAP |
| Ga0209213_10870142 | 3300027383 | Forest Soil | SLVLGYLAISRGVIIEPPAFIANAITAVMERIAQRTSALMGQTP |
| Ga0209283_100257531 | 3300027875 | Vadose Zone Soil | VLGYVAISRGVIIEPPAFVANAIAAITERIAQRAGTVTGQAP |
| Ga0209382_122798762 | 3300027909 | Populus Rhizosphere | YLAISRGVIIEPPAFVANTITAIMERITQRANALMGQPS |
| Ga0307317_103458582 | 3300028720 | Soil | LAVSFVLGYLAISRGVIIEPPAFVANAITALIERISQRTSALMGQTP |
| Ga0307282_106462931 | 3300028784 | Soil | PIALVLPYLALAAGSVLGYLAISRGVIIEPPAAIAQFINTVIERLAQRTNAAMGQAP |
| Ga0307290_100023906 | 3300028791 | Soil | LAISRGVIIEPPAFIANAITALIERIAQRTSALMGQTP |
| Ga0307286_100860332 | 3300028876 | Soil | VLGYLAISRGVIIEPPAFIANAITAVMERIAQRTSALMGQTP |
| Ga0308199_10037351 | 3300031094 | Soil | AISRGVIIEPPAFIANAITALIERIAQRTSALMGQTP |
| Ga0307495_101734062 | 3300031199 | Soil | SRAMIIEPPVFITNAISAIMESIARRSGAAMGQAP |
| Ga0307496_100479521 | 3300031200 | Soil | IALAVSFVLGYLAISRGVIIEPPAFVANAITALIERISQRTSALMGQTP |
| Ga0318516_102792691 | 3300031543 | Soil | AISRGVIIEPPAFIANAITAVMERVARRTNALMGQAP |
| Ga0318538_103673252 | 3300031546 | Soil | YIAISRGVIIEPPAFIANAITAVMERVARRTNALMGQAP |
| Ga0318555_104106022 | 3300031640 | Soil | IAISRGVIIEPPAFIANAITAVMERVARRTNALMGQAP |
| Ga0318560_101265751 | 3300031682 | Soil | LGYIAISRGVIIEPPVFIANAITAGMERVARRTNALMGQAP |
| Ga0310813_100263914 | 3300031716 | Soil | ISRGVIIEPPAFVANAITAIMERIAQRTSALMGQTP |
| Ga0318500_101876262 | 3300031724 | Soil | IAISRGVIIEPPAFVANAITAIMERIAQRTNALMGQAP |
| Ga0318500_104849571 | 3300031724 | Soil | VLGYIAISRGVIIEPPAFVANAITAVMERIARRTNALMGQAP |
| Ga0318554_107463452 | 3300031765 | Soil | TFVLGYIAISRGVIIEPPAFIANAITRVMERLTQRTTALMGQTP |
| Ga0318546_110402571 | 3300031771 | Soil | AVLLLPYLALAAAFGLGYFAISRAVIIEPPVFVTNAITALMESIARRTGAAMGQAP |
| Ga0318512_101440482 | 3300031846 | Soil | AISRGVIIEPPAFVANAITAVMERVARRTNALMGQAP |
| Ga0318544_104019921 | 3300031880 | Soil | ALIATFVLGYIAISRGVIIEPPAFIANAITRVMERLTQRTTALMGQTP |
| Ga0318520_100029106 | 3300031897 | Soil | LALTAAFVLGYIAISRGVIIEPPAFVANAITAIMERIAQRTNALMGQAP |
| Ga0306921_116023451 | 3300031912 | Soil | SRGVIIEPPAFIANAITAVMERVARRTNALMGQAP |
| Ga0310913_100854733 | 3300031945 | Soil | ISRGVIIEPPAFIANAITAVMERVARRTNALMGQAP |
| Ga0310909_106646182 | 3300031947 | Soil | LALIATFVLGYIAISRGVIIEPPAFIANAITRVMERLTQRTTALMGQTP |
| Ga0310911_104057462 | 3300032035 | Soil | AAFVLGYIAISRGVIIEPPAFIANAITAVMERVARRTNALMGQAP |
| Ga0318540_105627241 | 3300032094 | Soil | MAAFVLGYIAISRGVIIEPPAFVANAITAVMERVARRTNALMGQAP |
| Ga0306920_1020001122 | 3300032261 | Soil | ALPYAGMIAAFVLGYLAISRGVIIEPPAFVANLIAAVTERLAQRTNAVAGQTP |
| ⦗Top⦘ |