


| Basic Information | |
|---|---|
| Family ID | F098097 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MIKTGFFAVELAAQILLAAAIGLFVSIVLAGAVLLLAA |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 86.87 % |
| % of genes near scaffold ends (potentially truncated) | 12.50 % |
| % of genes from short scaffolds (< 2000 bps) | 64.42 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.885 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (13.462 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.462 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (26.923 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.52% β-sheet: 0.00% Coil/Unstructured: 48.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 28.85 |
| PF06123 | CreD | 27.88 |
| PF00486 | Trans_reg_C | 18.27 |
| PF13417 | GST_N_3 | 5.77 |
| PF01266 | DAO | 1.92 |
| PF08282 | Hydrolase_3 | 1.92 |
| PF16901 | DAO_C | 1.92 |
| PF01546 | Peptidase_M20 | 0.96 |
| PF05137 | PilN | 0.96 |
| PF00672 | HAMP | 0.96 |
| PF02874 | ATP-synt_ab_N | 0.96 |
| PF00528 | BPD_transp_1 | 0.96 |
| PF00119 | ATP-synt_A | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG4452 | Inner membrane protein CreD involved in colicin E2 resistance | Defense mechanisms [V] | 27.88 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 1.92 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 1.92 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 1.92 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 1.92 |
| COG3166 | Type IV pilus assembly protein PilN | Cell motility [N] | 1.92 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 1.92 |
| COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.88 % |
| All Organisms | root | All Organisms | 47.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005468|Ga0070707_100159448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2198 | Open in IMG/M |
| 3300005538|Ga0070731_10000193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 106091 | Open in IMG/M |
| 3300005617|Ga0068859_100030880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5377 | Open in IMG/M |
| 3300005829|Ga0074479_10553221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 1433 | Open in IMG/M |
| 3300005830|Ga0074473_10760633 | Not Available | 1273 | Open in IMG/M |
| 3300005836|Ga0074470_11162907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10725 | Open in IMG/M |
| 3300005836|Ga0074470_11581404 | Not Available | 766 | Open in IMG/M |
| 3300006041|Ga0075023_100559887 | Not Available | 525 | Open in IMG/M |
| 3300006050|Ga0075028_100621985 | Not Available | 643 | Open in IMG/M |
| 3300006059|Ga0075017_100647646 | Not Available | 810 | Open in IMG/M |
| 3300006102|Ga0075015_100327442 | Not Available | 849 | Open in IMG/M |
| 3300006163|Ga0070715_10813514 | Not Available | 568 | Open in IMG/M |
| 3300006195|Ga0075366_10181905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 1277 | Open in IMG/M |
| 3300006854|Ga0075425_100210640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_39 | 2234 | Open in IMG/M |
| 3300007004|Ga0079218_12995396 | Not Available | 569 | Open in IMG/M |
| 3300009098|Ga0105245_10032191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4642 | Open in IMG/M |
| 3300009148|Ga0105243_12784853 | Not Available | 529 | Open in IMG/M |
| 3300009444|Ga0114945_10434038 | Not Available | 786 | Open in IMG/M |
| 3300009649|Ga0105855_1134317 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300009662|Ga0105856_1100894 | Not Available | 842 | Open in IMG/M |
| 3300009678|Ga0105252_10049980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_39 | 1580 | Open in IMG/M |
| 3300010391|Ga0136847_12013391 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300010391|Ga0136847_12918503 | Not Available | 568 | Open in IMG/M |
| 3300010397|Ga0134124_11081408 | Not Available | 818 | Open in IMG/M |
| 3300010401|Ga0134121_10014167 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6338 | Open in IMG/M |
| 3300010880|Ga0126350_10664412 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300011399|Ga0137466_1085414 | Not Available | 517 | Open in IMG/M |
| 3300011408|Ga0137460_1067907 | Not Available | 681 | Open in IMG/M |
| 3300011414|Ga0137442_1141920 | Not Available | 533 | Open in IMG/M |
| 3300011419|Ga0137446_1146403 | Not Available | 569 | Open in IMG/M |
| 3300011421|Ga0137462_1027332 | Not Available | 1153 | Open in IMG/M |
| 3300011430|Ga0137423_1228551 | Not Available | 553 | Open in IMG/M |
| 3300011436|Ga0137458_1270575 | Not Available | 518 | Open in IMG/M |
| 3300012041|Ga0137430_1104202 | Not Available | 803 | Open in IMG/M |
| 3300012671|Ga0137318_1009145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300014324|Ga0075352_1114823 | Not Available | 722 | Open in IMG/M |
| 3300014870|Ga0180080_1060771 | Not Available | 640 | Open in IMG/M |
| 3300014872|Ga0180087_1082427 | Not Available | 618 | Open in IMG/M |
| 3300015084|Ga0167654_1014401 | Not Available | 1322 | Open in IMG/M |
| 3300015192|Ga0167646_1064587 | Not Available | 816 | Open in IMG/M |
| 3300015195|Ga0167658_1004565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4865 | Open in IMG/M |
| 3300015201|Ga0173478_10225578 | Not Available | 803 | Open in IMG/M |
| 3300015203|Ga0167650_1058906 | Not Available | 947 | Open in IMG/M |
| 3300015248|Ga0180079_1031569 | Not Available | 717 | Open in IMG/M |
| 3300015256|Ga0180073_1130006 | Not Available | 544 | Open in IMG/M |
| 3300017965|Ga0190266_10568612 | Not Available | 678 | Open in IMG/M |
| 3300018084|Ga0184629_10038598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2115 | Open in IMG/M |
| 3300018084|Ga0184629_10375075 | Not Available | 748 | Open in IMG/M |
| 3300018481|Ga0190271_11225551 | Not Available | 872 | Open in IMG/M |
| 3300018481|Ga0190271_11776311 | Not Available | 729 | Open in IMG/M |
| 3300018481|Ga0190271_12406655 | Not Available | 630 | Open in IMG/M |
| 3300019458|Ga0187892_10003017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 31805 | Open in IMG/M |
| 3300021859|Ga0210334_10033483 | Not Available | 981 | Open in IMG/M |
| 3300022309|Ga0224510_10071310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1924 | Open in IMG/M |
| (restricted) 3300023208|Ga0233424_10063600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1672 | Open in IMG/M |
| 3300025311|Ga0209343_10129636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_39 | 2033 | Open in IMG/M |
| 3300025324|Ga0209640_10021805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5592 | Open in IMG/M |
| 3300025324|Ga0209640_10096575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2548 | Open in IMG/M |
| 3300025324|Ga0209640_10227324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1579 | Open in IMG/M |
| 3300025505|Ga0207929_1000184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 17596 | Open in IMG/M |
| 3300025922|Ga0207646_10123348 | All Organisms → cellular organisms → Bacteria | 2329 | Open in IMG/M |
| 3300025927|Ga0207687_10052396 | All Organisms → cellular organisms → Bacteria | 2848 | Open in IMG/M |
| 3300025934|Ga0207686_10213330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_39 | 1389 | Open in IMG/M |
| 3300025942|Ga0207689_10988956 | Not Available | 710 | Open in IMG/M |
| 3300026075|Ga0207708_10386619 | Not Available | 1155 | Open in IMG/M |
| 3300026075|Ga0207708_10884898 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300026102|Ga0208914_1048391 | Not Available | 526 | Open in IMG/M |
| 3300027829|Ga0209773_10187142 | Not Available | 865 | Open in IMG/M |
| 3300027843|Ga0209798_10576152 | Not Available | 504 | Open in IMG/M |
| 3300027869|Ga0209579_10009138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium GR16-43 | 6210 | Open in IMG/M |
| 3300027894|Ga0209068_10058727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_39 | 1966 | Open in IMG/M |
| 3300027894|Ga0209068_10115645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_39 | 1428 | Open in IMG/M |
| 3300027911|Ga0209698_10049465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3695 | Open in IMG/M |
| 3300027915|Ga0209069_11038329 | Not Available | 505 | Open in IMG/M |
| 3300029987|Ga0311334_10904996 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300031576|Ga0247727_10064222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4252 | Open in IMG/M |
| 3300031576|Ga0247727_10353173 | Not Available | 1214 | Open in IMG/M |
| 3300031720|Ga0307469_11116132 | Not Available | 742 | Open in IMG/M |
| 3300031726|Ga0302321_102971342 | Not Available | 553 | Open in IMG/M |
| 3300031965|Ga0326597_10126389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3083 | Open in IMG/M |
| 3300032018|Ga0315272_10220237 | Not Available | 908 | Open in IMG/M |
| 3300032157|Ga0315912_10000292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 103094 | Open in IMG/M |
| 3300032157|Ga0315912_10056214 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3111 | Open in IMG/M |
| 3300032163|Ga0315281_10060763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4536 | Open in IMG/M |
| 3300032163|Ga0315281_10115718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3085 | Open in IMG/M |
| 3300032163|Ga0315281_10140728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2747 | Open in IMG/M |
| 3300032163|Ga0315281_11703665 | Not Available | 611 | Open in IMG/M |
| 3300032205|Ga0307472_102484982 | Not Available | 527 | Open in IMG/M |
| 3300032256|Ga0315271_10395874 | Not Available | 1156 | Open in IMG/M |
| 3300032275|Ga0315270_10201956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SG8_39 | 1219 | Open in IMG/M |
| 3300032770|Ga0335085_10053340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5448 | Open in IMG/M |
| 3300032770|Ga0335085_10228158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2257 | Open in IMG/M |
| 3300032782|Ga0335082_11066094 | Not Available | 673 | Open in IMG/M |
| 3300032828|Ga0335080_10124143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2864 | Open in IMG/M |
| 3300032829|Ga0335070_10584349 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300032893|Ga0335069_10032334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7065 | Open in IMG/M |
| 3300032893|Ga0335069_10036744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6575 | Open in IMG/M |
| 3300032955|Ga0335076_10004462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14155 | Open in IMG/M |
| 3300032955|Ga0335076_10039872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4694 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 13.46% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.62% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.69% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.81% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 3.85% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 3.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.88% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 2.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.92% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.92% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.96% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.96% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.96% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.96% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.96% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.96% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.96% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011399 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT842_2 | Environmental | Open in IMG/M |
| 3300011408 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT723_2 | Environmental | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012671 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT300_2 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
| 3300014872 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10D | Environmental | Open in IMG/M |
| 3300015084 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine) | Environmental | Open in IMG/M |
| 3300015192 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface) | Environmental | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015248 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT530_16_10D | Environmental | Open in IMG/M |
| 3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300021859 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300023208 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG | Environmental | Open in IMG/M |
| 3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026102 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070707_1001594483 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQPTRRLSMIKTGFFAVEVAAQILLAAAIGLFVSVVLAGAVLLLAA* |
| Ga0070731_1000019369 | 3300005538 | Surface Soil | MVKTRMFAVELAAQIVLAAAIGTFVAIVLAGATMLLAA* |
| Ga0068859_1000308803 | 3300005617 | Switchgrass Rhizosphere | MIKTGFFAVELAAQILLAAAIGLSVSIVLAGAVLLLAA* |
| Ga0074479_105532211 | 3300005829 | Sediment (Intertidal) | MIKTGFFAVELAAQILLAAGIGLSVSVVLAGAVLLLAA* |
| Ga0074473_107606332 | 3300005830 | Sediment (Intertidal) | MTRSTMFAVELAAQCLLAGAVGLLVSIVLAFVVLLLAA* |
| Ga0074470_111629077 | 3300005836 | Sediment (Intertidal) | MLKTGYFAVEIAAQILLAAAIGLFVSIVLAGVVLLLAA* |
| Ga0074470_115814042 | 3300005836 | Sediment (Intertidal) | MFKTGFFAVELAAQILLASAIGLFVSLVLSGAVLLLAAA* |
| Ga0075023_1005598872 | 3300006041 | Watersheds | MIKTGFFAVELAAQILLAASIGLFVSIVLAGAVLLLAA* |
| Ga0075028_1006219852 | 3300006050 | Watersheds | MVKTRMFAVELAAQIVLAAAIGVFVAVVLAGVTMLLAA* |
| Ga0075017_1006476462 | 3300006059 | Watersheds | MVKNRMIAVELAAQVALACAIGIFVALVLAGATMLLAAGPSG* |
| Ga0075015_1003274421 | 3300006102 | Watersheds | MNRQTTTVFAIELATQIALAAAVGLLVSLALAAAA |
| Ga0070715_108135143 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MQDIEREMSMTKTLHYAVELSAQIVLAAAVGLFVSIALAGAVLLLAA* |
| Ga0075366_101819053 | 3300006195 | Populus Endosphere | MTKQPPFIVEIAAQITLALAIGLFVSIVLAGITLLLAA* |
| Ga0075425_1002106402 | 3300006854 | Populus Rhizosphere | MIKTGFFAVELAAQILLAAAIGLFVSIVLAGAVLLLAA* |
| Ga0079218_129953962 | 3300007004 | Agricultural Soil | MIKTGYFAVELAAQILLAAAIGLFVSIVLAGAVLLLAA* |
| Ga0111539_110205871 | 3300009094 | Populus Rhizosphere | AAEIVAQVALASAIGVCVSIVLAGAALLLAGGPA* |
| Ga0105245_100321912 | 3300009098 | Miscanthus Rhizosphere | MIKTGFFAVELAAQVLLAAAIGLSVSIVLAGAVLLLAA* |
| Ga0105243_127848532 | 3300009148 | Miscanthus Rhizosphere | MIKTGFFAVELAAQILLAAAVGLFVSIVLAGAVLLLAA* |
| Ga0114945_104340381 | 3300009444 | Thermal Springs | RRRARMSKSKLFALELAAQVVLAAAVGLFVSVVLAGAAMLLAA* |
| Ga0105855_11343173 | 3300009649 | Permafrost Soil | SPNMVKTRMFAVELAAQIVLAAAVGTFVAIVLAGAAMLLAA* |
| Ga0105856_11008942 | 3300009662 | Permafrost Soil | MVKTRMFAVELAAQIVLAAAIGTFVAIVLAGAAMLLAA* |
| Ga0105252_100499803 | 3300009678 | Soil | MSMTRSTLFAVELASQIALAAAVGLFVSIVLAGAVLLLAA* |
| Ga0136847_120133911 | 3300010391 | Freshwater Sediment | IMVKTSIFAVELAAQIVLAAAIGLFASIVLASITLLLAA* |
| Ga0136847_129185032 | 3300010391 | Freshwater Sediment | MRIVDKEKRMTKTSTFAVELATQIVLAAAIGLVASIVLAGGALLLAA* |
| Ga0134124_110814082 | 3300010397 | Terrestrial Soil | MSMTKSLHQAVEISAQIALAAAVGLFVSIALGSAV |
| Ga0134121_100141675 | 3300010401 | Terrestrial Soil | MSMTKSLHQAVEISAQIALAAAVGLFVSIALGSAVLLLAA* |
| Ga0126350_106644122 | 3300010880 | Boreal Forest Soil | MVKTRMFAVELAAQIVLAAAIGIFVAVVLAGAAMLLAA* |
| Ga0137466_10854142 | 3300011399 | Soil | MLKPGFFAIELSTQILLAGAIGLFASIVLAGAVLLLAA* |
| Ga0137460_10679071 | 3300011408 | Soil | MVKSREFVVELAAQILLAAAIGVSVSIMLAGAALLLAA* |
| Ga0137442_11419202 | 3300011414 | Soil | MTKSTLFAAELAEQIVLAAAIGLFVSIVLAGVAMLLAA* |
| Ga0137446_11464033 | 3300011419 | Soil | MTGSTLFAMELATQIVLAGAVGLFVSIVLAGAALLLAA* |
| Ga0137462_10273322 | 3300011421 | Soil | MIKTGFFAVEVAAQILLAAAIGLFVSIVLAGAVLLLAA* |
| Ga0137423_12285512 | 3300011430 | Soil | MSMTRSTLFAVELATQIALAAAVGLFVSIALAGAVLLLAA* |
| Ga0137458_12705751 | 3300011436 | Soil | TMTGSTLFAMELATQIVLAGAVGLFVSIVLAGAALLLAA* |
| Ga0137430_11042023 | 3300012041 | Soil | LIKTGFFAVELAAQILLAAAIGLFVSIVLAGAVLLLAA* |
| Ga0137318_10091452 | 3300012671 | Soil | MVKTRMFAVELATQIVLATAIGLLASIVLAGGALLLAA* |
| Ga0075352_11148232 | 3300014324 | Natural And Restored Wetlands | MTRSALFAVELAAQIVLAAAVGLFVSIVLAGVAMLLAA* |
| Ga0180080_10607712 | 3300014870 | Soil | MSRSTSFAAELATQFVLASTVGLLVSIVLAGAALLLAA* |
| Ga0180087_10824271 | 3300014872 | Soil | MRIVNKEKRMTKTSTFAVELATQFVLAAAVGLLASIVLAGGALLLAA* |
| Ga0167654_10144012 | 3300015084 | Glacier Forefield Soil | MFKTGFFAVELAAQILLAAAIGLFVSIVLAGAVLLLAA* |
| Ga0167646_10645871 | 3300015192 | Glacier Forefield Soil | MIKTGFFAVELATQILLAASIGLFVSVVLAGAVLLLAA* |
| Ga0167658_10045651 | 3300015195 | Glacier Forefield Soil | MIKTGFFAVGLATQILLAASIGLSVSVVLAGAVLLLAA* |
| Ga0173478_102255781 | 3300015201 | Soil | MIKTGFFAVELAAQILLAAAIGLFVSIVLACVVLLLAA* |
| Ga0167650_10589062 | 3300015203 | Glacier Forefield Soil | MIKSGFFAVELAAQILLAASIGLFVSIVLAGAVLLLAA* |
| Ga0180079_10315691 | 3300015248 | Soil | MIKTGFFAVELAAQILLAVAIGFSVSIVLAGAVLLLAA* |
| Ga0180073_11300062 | 3300015256 | Soil | MNKTAFFAVELAAQIVLAAAIGLFVSIVLAGVALLLAA* |
| Ga0190266_105686121 | 3300017965 | Soil | RHPTRRTPMIKSGFFAVELAAQILLAAAIGLFVSIVLACFVLLLAA |
| Ga0184629_100385983 | 3300018084 | Groundwater Sediment | MNKPSTAVFAVELAAQIALAAAVGLFVSIVLAGAALLLAA |
| Ga0184629_103750752 | 3300018084 | Groundwater Sediment | MTKTSTFAVELATQFVLAAAVGLLASIVLAGGALLLAA |
| Ga0190271_112255512 | 3300018481 | Soil | MIKSGFFAVELAAQILLAAAIGLFVSVVLACFVLLLAA |
| Ga0190271_117763112 | 3300018481 | Soil | MIKTGFFAVELAAQILLAAAIGLFVSIVLACFVLLLAA |
| Ga0190271_124066553 | 3300018481 | Soil | MIKSGFFAVELAAQVLLAAAIGLFVSVVLACFVLLLAA |
| Ga0187892_1000301719 | 3300019458 | Bio-Ooze | MPKPGAYAVELAAQLALAAAIGFFVSIVLAGATLLLA |
| Ga0187893_100584713 | 3300019487 | Microbial Mat On Rocks | MPRPGTYAAELAAQIALAAAVGLCVSFLLAGATLLLA |
| Ga0210334_100334832 | 3300021859 | Estuarine | MTRSTMFAVELAAQCLLAGAVGLLVSIVLAFVVLLLAA |
| Ga0224510_100713103 | 3300022309 | Sediment | MIKTGLFAVELAAQILLAVAIGLCVSIVLAGTVLLLAA |
| (restricted) Ga0233424_100636003 | 3300023208 | Freshwater | MNSTRNFAVEIAAQVVLALAVGLFVSVLLAGATLLLAA |
| Ga0209343_101296364 | 3300025311 | Groundwater | MVKSREFAVELAAQIVLAAAIGASVSIVLASAVLLLAA |
| Ga0209520_100474324 | 3300025319 | Soil | MTITYKGTSMTRIRLFAAELATQIVLAAAIGLFASIALAGAALLLAA |
| Ga0209640_100218057 | 3300025324 | Soil | MTITYKGTSMTRIRLFAAELATQIVLAAAIGLFASIVLAGAALLLAA |
| Ga0209640_100965753 | 3300025324 | Soil | MTRSTIFAVELATQFVLAGVVGLLVSIALAAVTLLLAA |
| Ga0209640_102273243 | 3300025324 | Soil | MTRPTTYAIEIAAQLGLAAAIGLFVSIVLAGATLLLAA |
| Ga0207929_10001848 | 3300025505 | Arctic Peat Soil | MVKTRMFAVELAAQIVLAAAIGIFVAVVLAGAAMLLAA |
| Ga0207646_101233483 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKTGFFAVEVAAQILLAAAIGLFVSVVLAGAVLLLAA |
| Ga0207687_100523964 | 3300025927 | Miscanthus Rhizosphere | MIKTGFFAVELAAQILLAAAIGLFVSIVLAGAVLLLAA |
| Ga0207686_102133303 | 3300025934 | Miscanthus Rhizosphere | MIKTGFFAVELAAQVLLAAAIGLSVSIVLAGAVLLLAA |
| Ga0207689_109889561 | 3300025942 | Miscanthus Rhizosphere | MIKTGFFAVELAAQILLAAAIGLSVSIVLAGAVLLLAA |
| Ga0207708_103866193 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKTGFFAVELAAQILLAAAVGLFVSIVLAGAVLLLAA |
| Ga0207708_108848982 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKQPPFIVEIAAQVTLALAIGLFVSIVLAGITLLLAA |
| Ga0208914_10483911 | 3300026102 | Natural And Restored Wetlands | MTRSALFAVELAAQIVLAAAVGLFVSIVLAGVAMLLAA |
| Ga0209773_101871422 | 3300027829 | Bog Forest Soil | MVKTKMFAVELAAQIVLAAAIGTFVAIVLAGATMLLA |
| Ga0209798_105761521 | 3300027843 | Wetland Sediment | MIKTGLFAVELAAQVVLAAAIGLFVSIVLAGITMLLAA |
| Ga0209579_100091385 | 3300027869 | Surface Soil | MVKTRMFAVELAAQIVLAAAIGTFVAIVLAGATMLLAA |
| Ga0209068_100587271 | 3300027894 | Watersheds | MIKTGFFAVELAAQILLAASIGLFVSIVLAGAVLLLAA |
| Ga0209068_101156453 | 3300027894 | Watersheds | MVKTRMFAVELAAQIVLAAAIGVFVAVVLAGVTMLLAA |
| Ga0209698_100494655 | 3300027911 | Watersheds | MVKNRMIAVELAAQVALACAIGIFVALVLAGATMLLAAGPSG |
| Ga0209069_110383292 | 3300027915 | Watersheds | MIKTGFFAVELAAQVLLAAAIGFFVSIVLASAVLLL |
| Ga0311334_109049961 | 3300029987 | Fen | FTFFAVEVAAQVLLALAIGLFVSIVLVGAVLLLAAGPSA |
| Ga0247727_100642224 | 3300031576 | Biofilm | MIKTGIFAVELAAQIVLAASIGLFASLVLAGITLLLAA |
| Ga0247727_101013062 | 3300031576 | Biofilm | MTKPTPYVVEIAAQVALAAAVGMSVSIVLASATLLLAA |
| Ga0247727_103531732 | 3300031576 | Biofilm | MQATGKGTAMTSSKLFAVELLAQIVLAAAIGIFVSMVLVGATLLLAA |
| Ga0307469_111161322 | 3300031720 | Hardwood Forest Soil | MIKTGFFAVELAAQVLLAAAIGLSVCIVLAGAVLLLAA |
| Ga0302321_1029713422 | 3300031726 | Fen | MIKTGFLAVEIATQVLLAASIGLFVSVVLAGAVLLIAA |
| Ga0326597_101263891 | 3300031965 | Soil | MTRSTMFAVELATQFVLAGVVGLLVSIALAAVALLLAA |
| Ga0315272_102202371 | 3300032018 | Sediment | MIKTGFFAAELATQILLAAAIGLCVSIVLAGAVLLLAA |
| Ga0315912_1000029214 | 3300032157 | Soil | MTRSTSFAAELAAQIVLAAGIGLSVSIVLAGVAMLLAA |
| Ga0315912_100562145 | 3300032157 | Soil | MTRPEMFAVELATQIALAAGIGLCVSVVLACIAMLLAA |
| Ga0315281_100607635 | 3300032163 | Sediment | MTKITLFAVELATQTVLATAVGLFVSIVLAGFALLLAA |
| Ga0315281_101157185 | 3300032163 | Sediment | MTRTGYLAVELATQILLAAAIGLSVSIVLAGAVLLLAA |
| Ga0315281_101407284 | 3300032163 | Sediment | MVKSKEVALELTLQIVLAAAIGISVSIVLAGATLLLAA |
| Ga0315281_117036652 | 3300032163 | Sediment | MVKTSMFAVELAAQIVLATAIGIFVSIVLAGAVLLLAA |
| Ga0307472_1024849821 | 3300032205 | Hardwood Forest Soil | MMKTGFFAVELAAQILLAAAIGLSVSIVLAGAVLLLAA |
| Ga0315271_103958742 | 3300032256 | Sediment | MTRTRLFAVELAAQIGLAAAIGLFISTVLAGATLLLAA |
| Ga0315270_102019563 | 3300032275 | Sediment | MIKTGFFAAELATQILLAAAIGLCVSIVLAGAVQLLAA |
| Ga0335085_100533405 | 3300032770 | Soil | MTKQPPFVVELAAQIVLAAGIGLFVSIVLAGITVLLAA |
| Ga0335085_102281583 | 3300032770 | Soil | MTKSIPLAVELAAQVALATAIGLFVSIVLACVVILIAE |
| Ga0335082_110660942 | 3300032782 | Soil | MTKSIPLAVELAAQVALATAIGLFVSIVLACVVILLAA |
| Ga0335080_101241433 | 3300032828 | Soil | MINTSQHVVELAAQVALAAAIGLFVSLALAGAVLLLAA |
| Ga0335070_105843493 | 3300032829 | Soil | VTKTLHHAVEISAQIVLAAAVGLFVSITLAGAVLLLAA |
| Ga0335069_100323345 | 3300032893 | Soil | MINTGQHVVELAAQVVLAAAVGLFVSLALAGGVLLLAA |
| Ga0335069_100367447 | 3300032893 | Soil | MIRLFAVELAAQIVLAAAIGIFVSIVLAGAAMLLAA |
| Ga0335076_1000446215 | 3300032955 | Soil | MIRTMHHAVEIAAQVVLAAAVGLFVSVALAGAVLLLAA |
| Ga0335076_100398725 | 3300032955 | Soil | MIKSIPFAVELAAQVALAAAIGLFVSIVLACAVILLAA |
| Ga0335084_100021656 | 3300033004 | Soil | MINTSQHVVELAAQVALAAAVGLFVSLALAGGVLLLAA |
| ⦗Top⦘ |