


| Basic Information | |
|---|---|
| Family ID | F098093 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 48 residues |
| Representative Sequence | LYQDVEVTPDVDFARLTDVLVVVAPPPAPDPDPGSHHTPGRGLAVIK |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.12 % |
| % of genes from short scaffolds (< 2000 bps) | 88.46 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.462 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.539 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.192 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.00% β-sheet: 0.00% Coil/Unstructured: 92.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF04093 | MreD | 78.85 |
| PF03717 | PBP_dimer | 13.46 |
| PF01098 | FTSW_RODA_SPOVE | 1.92 |
| PF03972 | MmgE_PrpD | 0.96 |
| PF02472 | ExbD | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG2891 | Cell shape-determining protein MreD | Cell wall/membrane/envelope biogenesis [M] | 78.85 |
| COG0768 | Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2) | Cell cycle control, cell division, chromosome partitioning [D] | 13.46 |
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 1.92 |
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.96 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.46 % |
| All Organisms | root | All Organisms | 36.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002128|JGI24036J26619_10133631 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300004114|Ga0062593_100016068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3759 | Open in IMG/M |
| 3300004153|Ga0063455_100257274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 920 | Open in IMG/M |
| 3300004156|Ga0062589_100081524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → Haliangium ochraceum | 1976 | Open in IMG/M |
| 3300004156|Ga0062589_100987443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 785 | Open in IMG/M |
| 3300004157|Ga0062590_102729250 | Not Available | 527 | Open in IMG/M |
| 3300004479|Ga0062595_100431460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 959 | Open in IMG/M |
| 3300004643|Ga0062591_100238061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1376 | Open in IMG/M |
| 3300005328|Ga0070676_11283792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 559 | Open in IMG/M |
| 3300005329|Ga0070683_102354831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 511 | Open in IMG/M |
| 3300005338|Ga0068868_100718645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 895 | Open in IMG/M |
| 3300005338|Ga0068868_102146447 | Not Available | 532 | Open in IMG/M |
| 3300005356|Ga0070674_102038396 | Not Available | 523 | Open in IMG/M |
| 3300005365|Ga0070688_100520610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 900 | Open in IMG/M |
| 3300005367|Ga0070667_100518425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1094 | Open in IMG/M |
| 3300005450|Ga0066682_10645413 | Not Available | 658 | Open in IMG/M |
| 3300005546|Ga0070696_101987498 | Not Available | 505 | Open in IMG/M |
| 3300005615|Ga0070702_101327011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 585 | Open in IMG/M |
| 3300005841|Ga0068863_101156527 | Not Available | 779 | Open in IMG/M |
| 3300005843|Ga0068860_101368114 | Not Available | 729 | Open in IMG/M |
| 3300005944|Ga0066788_10028977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae | 1255 | Open in IMG/M |
| 3300005993|Ga0080027_10439398 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006163|Ga0070715_10890199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 547 | Open in IMG/M |
| 3300006176|Ga0070765_100505336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1136 | Open in IMG/M |
| 3300009093|Ga0105240_10766582 | Not Available | 1048 | Open in IMG/M |
| 3300009156|Ga0111538_13771802 | Not Available | 525 | Open in IMG/M |
| 3300009610|Ga0105340_1558181 | Not Available | 511 | Open in IMG/M |
| 3300010358|Ga0126370_12314677 | Not Available | 532 | Open in IMG/M |
| 3300010400|Ga0134122_11066914 | Not Available | 797 | Open in IMG/M |
| 3300010400|Ga0134122_12753427 | Not Available | 544 | Open in IMG/M |
| 3300010401|Ga0134121_11444245 | Not Available | 700 | Open in IMG/M |
| 3300011403|Ga0137313_1057808 | Not Available | 682 | Open in IMG/M |
| 3300011412|Ga0137424_1116796 | Not Available | 555 | Open in IMG/M |
| 3300011443|Ga0137457_1245571 | Not Available | 612 | Open in IMG/M |
| 3300012882|Ga0157304_1060986 | Not Available | 605 | Open in IMG/M |
| 3300012898|Ga0157293_10307812 | Not Available | 526 | Open in IMG/M |
| 3300012910|Ga0157308_10133571 | Not Available | 773 | Open in IMG/M |
| 3300012944|Ga0137410_11553704 | Not Available | 579 | Open in IMG/M |
| 3300012961|Ga0164302_11932313 | Not Available | 503 | Open in IMG/M |
| 3300013296|Ga0157374_10511569 | Not Available | 1206 | Open in IMG/M |
| 3300013296|Ga0157374_12556544 | Not Available | 538 | Open in IMG/M |
| 3300014969|Ga0157376_13125007 | Not Available | 501 | Open in IMG/M |
| 3300015200|Ga0173480_10800049 | Not Available | 602 | Open in IMG/M |
| 3300015373|Ga0132257_100195173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2396 | Open in IMG/M |
| 3300015374|Ga0132255_100987411 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1262 | Open in IMG/M |
| 3300016371|Ga0182034_11560718 | Not Available | 579 | Open in IMG/M |
| 3300019362|Ga0173479_10754687 | Not Available | 532 | Open in IMG/M |
| 3300020005|Ga0193697_1025602 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1471 | Open in IMG/M |
| 3300021082|Ga0210380_10452238 | Not Available | 588 | Open in IMG/M |
| 3300021181|Ga0210388_10038049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3983 | Open in IMG/M |
| 3300022756|Ga0222622_11332017 | Not Available | 528 | Open in IMG/M |
| 3300025703|Ga0208357_1103506 | Not Available | 842 | Open in IMG/M |
| 3300025903|Ga0207680_10628625 | Not Available | 768 | Open in IMG/M |
| 3300025905|Ga0207685_10406085 | Not Available | 699 | Open in IMG/M |
| 3300025913|Ga0207695_11745428 | Not Available | 503 | Open in IMG/M |
| 3300025918|Ga0207662_10122682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter | 1631 | Open in IMG/M |
| 3300025919|Ga0207657_10738061 | Not Available | 763 | Open in IMG/M |
| 3300025930|Ga0207701_10410986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1165 | Open in IMG/M |
| 3300025936|Ga0207670_10076056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2335 | Open in IMG/M |
| 3300025936|Ga0207670_10127865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1857 | Open in IMG/M |
| 3300025936|Ga0207670_10884646 | Not Available | 747 | Open in IMG/M |
| 3300025940|Ga0207691_11089217 | Not Available | 665 | Open in IMG/M |
| 3300025942|Ga0207689_10826587 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300025986|Ga0207658_10474023 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300026023|Ga0207677_11150901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 709 | Open in IMG/M |
| 3300026041|Ga0207639_10648484 | Not Available | 977 | Open in IMG/M |
| 3300026075|Ga0207708_10584712 | Not Available | 944 | Open in IMG/M |
| 3300026088|Ga0207641_10895098 | Not Available | 881 | Open in IMG/M |
| 3300026088|Ga0207641_11656151 | Not Available | 642 | Open in IMG/M |
| 3300026088|Ga0207641_11885532 | Not Available | 599 | Open in IMG/M |
| 3300026088|Ga0207641_11965285 | Not Available | 586 | Open in IMG/M |
| 3300026095|Ga0207676_10833835 | Not Available | 901 | Open in IMG/M |
| 3300026116|Ga0207674_11880461 | Not Available | 565 | Open in IMG/M |
| 3300026118|Ga0207675_100638654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1070 | Open in IMG/M |
| 3300026142|Ga0207698_10663796 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300026142|Ga0207698_12688296 | Not Available | 506 | Open in IMG/M |
| 3300026215|Ga0209849_1077230 | Not Available | 587 | Open in IMG/M |
| 3300028293|Ga0247662_1045372 | Not Available | 761 | Open in IMG/M |
| 3300028379|Ga0268266_11491212 | Not Available | 652 | Open in IMG/M |
| 3300028573|Ga0265334_10111214 | Not Available | 984 | Open in IMG/M |
| 3300031239|Ga0265328_10406589 | Not Available | 534 | Open in IMG/M |
| 3300031249|Ga0265339_10376610 | Not Available | 666 | Open in IMG/M |
| 3300031344|Ga0265316_10085918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2406 | Open in IMG/M |
| 3300031521|Ga0311364_11270748 | Not Available | 730 | Open in IMG/M |
| 3300031538|Ga0310888_10076144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1648 | Open in IMG/M |
| 3300031561|Ga0318528_10229270 | Not Available | 995 | Open in IMG/M |
| 3300031561|Ga0318528_10455371 | Not Available | 687 | Open in IMG/M |
| 3300031640|Ga0318555_10031607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2581 | Open in IMG/M |
| 3300031711|Ga0265314_10019478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 5259 | Open in IMG/M |
| 3300031726|Ga0302321_100055923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3821 | Open in IMG/M |
| 3300031751|Ga0318494_10143471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1341 | Open in IMG/M |
| 3300031794|Ga0318503_10011310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2357 | Open in IMG/M |
| 3300031819|Ga0318568_10239585 | Not Available | 1122 | Open in IMG/M |
| 3300031835|Ga0318517_10406141 | Not Available | 615 | Open in IMG/M |
| 3300031860|Ga0318495_10356983 | Not Available | 647 | Open in IMG/M |
| 3300031939|Ga0308174_10783808 | Not Available | 800 | Open in IMG/M |
| 3300031943|Ga0310885_10384715 | Not Available | 744 | Open in IMG/M |
| 3300031959|Ga0318530_10306645 | Not Available | 656 | Open in IMG/M |
| 3300032002|Ga0307416_102218831 | Not Available | 650 | Open in IMG/M |
| 3300032094|Ga0318540_10442882 | Not Available | 628 | Open in IMG/M |
| 3300032261|Ga0306920_100829146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1356 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 4.81% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.85% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.88% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.92% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.96% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025703 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300028293 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK03 | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1082355611 | 3300001213 | Wetland | DVDFARLSEVLVVVAPAPPPDPEAAVKKPLAPAHGLSVYR* |
| JGI24036J26619_101336311 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | EVTPDVDFARLTDVLVVVAPPPTPDPEPGSHHAPGRGLTVIK* |
| C688J35102_1178561042 | 3300002568 | Soil | DVDFARLSEVLVVVAPPPSADPEAGPRKALAPARGLAVYR* |
| Ga0062593_1000160684 | 3300004114 | Soil | PGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPTPDPEPGSHHTPGRGLAVMK* |
| Ga0063455_1002572741 | 3300004153 | Soil | GLYQDVEVTPDVDFARLSEVLVVVAPPPAPDTDPAARRLPARGPMVYR* |
| Ga0062589_1000815241 | 3300004156 | Soil | GAVGLYQDVEVTPDVDFARLTDVLVVVAPPPTPDPEPGSHHTPGRGLAVMK* |
| Ga0062589_1009874432 | 3300004156 | Soil | QDVEVTPDVDFARLTDVLVVVAPPPAPDPDPASHHTPGRGLAVIK* |
| Ga0062590_1027292501 | 3300004157 | Soil | YQDVEVTPDVDFARLTDVLVVVAPPPAPDPDPGSHHTPGRGLAVIK* |
| Ga0062595_1004314603 | 3300004479 | Soil | IIPGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPAPDPDPGSHHTPGRGLAVIK* |
| Ga0062591_1002380611 | 3300004643 | Soil | YQDVEVTPDVDFARLTDVLVVVAPPPTPDPEPGSHHTPGRGLAVMK* |
| Ga0070676_112837921 | 3300005328 | Miscanthus Rhizosphere | PGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPAPDPDPGSHHTPGRGLTVFK* |
| Ga0070683_1023548311 | 3300005329 | Corn Rhizosphere | VEVTPDVDFARLSEVLVVVAPPPAADPEAGSRRTAPPARGLSVYR* |
| Ga0068868_1007186451 | 3300005338 | Miscanthus Rhizosphere | YQDVEVTPDVDFARLSDVLVVVAPPPTPDPEPGSHHLPARGLSVIK* |
| Ga0068868_1021464471 | 3300005338 | Miscanthus Rhizosphere | GAVGLYQDVEVTPDVDFARLTDVLVVVAPPPTPDPEPGSHHAPGRGLTVIK* |
| Ga0070674_1020383961 | 3300005356 | Miscanthus Rhizosphere | VTPDVDFARLTDVLVVVAPPPAPDPDPGSHHTPGRGMAVIK* |
| Ga0070688_1005206101 | 3300005365 | Switchgrass Rhizosphere | QDVEVTPDVDFARLTDVLVVVAPPPAPDPEPASHHTPGRGLTVFK* |
| Ga0070667_1005184253 | 3300005367 | Switchgrass Rhizosphere | IIPGAVGLYQDVEVTPDVDFARLTDVLVIVAPPPAPDPEPSSHHTPGRGLTVIK* |
| Ga0066682_106454132 | 3300005450 | Soil | PGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPAADPDPGSHHAPGRGLAVIK* |
| Ga0070696_1019874981 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | FPRNMAVGHITRVIPGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPTPDPEPGSHHTPGRGLAVMK* |
| Ga0070702_1013270112 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | IPDVDFARLSEVLVVVAPPPAPDPEAGGRKTLAPARGLAVYR* |
| Ga0068863_1011565271 | 3300005841 | Switchgrass Rhizosphere | DVDFARLTDVLVVVAPPPAADPDPGSHHTPGRGLAVIK* |
| Ga0068860_1013681142 | 3300005843 | Switchgrass Rhizosphere | SEVLVVVAPPPSADPDAGTRRSFQPTPARGLSVYR* |
| Ga0066788_100289773 | 3300005944 | Soil | FARLSEVLVVAAPPPAPDPDAGLHRSSATPARGPMIYK* |
| Ga0080027_104393982 | 3300005993 | Prmafrost Soil | RDLSVGHVTAVLPGAVGLRQEVEVTPDVDFARLSEVLVVAAPPPAADPDAGTHRSSAPARGPMVYR* |
| Ga0070715_108901992 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | QEVEVTPDVDFARLSEVLVVVAPPPAPDPESGTRRASSGLPSRGLSVYR* |
| Ga0070765_1005053361 | 3300006176 | Soil | LYQDVEVTPDVDFARLSEVLVVVAPPPAPDTDPAARRLPARGPMVYR* |
| Ga0105240_107665823 | 3300009093 | Corn Rhizosphere | VGLYQDVEVTPDVDFARLSEVLVVVAPPPAPDTDPAARRLPARGPMVYR* |
| Ga0111538_137718022 | 3300009156 | Populus Rhizosphere | VTPDVDFARLADVLVVVAPPPTPDPDPSSHHAPARGLTLIK* |
| Ga0105340_15581812 | 3300009610 | Soil | IVPGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPAPDPEPGSHHTPGRGLTVFK* |
| Ga0126370_123146772 | 3300010358 | Tropical Forest Soil | VGLYQDVEVTPDVDFARLTDVLVVVAPPPAPDPDPGSHHTPGRGLAVIK* |
| Ga0134122_110669141 | 3300010400 | Terrestrial Soil | LYQDVEVTPDVDFARLTDVLVVVAPPPAPDPDPGSHHTPGRGLAVIK* |
| Ga0134122_127534271 | 3300010400 | Terrestrial Soil | IIPGAVGLYQDVEVTPDVDFARLSDVLVVVAAPPAPDPDPSSHHLPARGLSVIK* |
| Ga0134121_114442452 | 3300010401 | Terrestrial Soil | GHVTRIIPGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPAPDPEPGAHHAPGRGLAVIK* |
| Ga0137313_10578082 | 3300011403 | Soil | EVTPDVDFARLTDVLVVVAPPPAPDPDPGSHHAPGRGLTVFK* |
| Ga0137424_11167962 | 3300011412 | Soil | PDVDFARLTDVLVVVAPPPAPDPDPGSHHTPGRGLTVFK* |
| Ga0137457_12455712 | 3300011443 | Soil | GLYQDVEVTPDVDFARLTDVLVVVAPPPAPDPDPGSHHAPGRGLTVFK* |
| Ga0157304_10609862 | 3300012882 | Soil | NLAVGHVTRIIPGAVGLYQDVEVTPDVDFARLTDVLVIVAPPPAPDPEPSSHHAPGRGLTVIK* |
| Ga0157293_103078121 | 3300012898 | Soil | QEVEVTPDVDFARLADVLVVVAPPPTPDPDPSSHHAPARGLTLIK* |
| Ga0157308_101335712 | 3300012910 | Soil | IPGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPTPDPEPGSHHTPGRGLAVMK* |
| Ga0137410_115537042 | 3300012944 | Vadose Zone Soil | AVGLFQEVEVTPDVDFARLSEVLGVAAPPPAADPDAGTHRSGAPARGPMVYK* |
| Ga0164302_119323132 | 3300012961 | Soil | VDFARLQDVLVVVAPPPAPDPDPASHHTPGRGVAVFK* |
| Ga0157374_105115693 | 3300013296 | Miscanthus Rhizosphere | ITRVIPGAVGRYQDVEVTPDVDFARLSEVLVVVAPPPAPDTDPAARRLPARGPMVYR* |
| Ga0157374_125565442 | 3300013296 | Miscanthus Rhizosphere | PGAVGLYQDVEVTPDVDVARLTDVRVVVAPPPAPDPDPGSHHTPGRGLAVIK* |
| Ga0157376_131250072 | 3300014969 | Miscanthus Rhizosphere | PDVDFARLTDVLVIVAPPPAPDPEPSSHHTPGRGLTVIK* |
| Ga0173480_108000492 | 3300015200 | Soil | MAVGHVTRIIPGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPAPDPDPGSHHTPGRGLTVFK* |
| Ga0132257_1001951731 | 3300015373 | Arabidopsis Rhizosphere | IIPGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPAPDPDPAAHHTPGRGLAIIK* |
| Ga0132255_1009874111 | 3300015374 | Arabidopsis Rhizosphere | RNLAVGHVTRIIPGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPTPDPEPGSHHAPGRGLTVIK* |
| Ga0182034_115607182 | 3300016371 | Soil | VTKVIPGAVGLYQDVEVTPDVDFGRLADVLVVVAPPPAPDPEAGSHHQPARGLMVYR |
| Ga0173479_107546872 | 3300019362 | Soil | GAVGLYQDVEVTPDVDFARLTDVLVVVAPPPTPDPEPGSHHTPGRGLAVMK |
| Ga0193697_10256021 | 3300020005 | Soil | QDVEVTPDVDFARLADVLIVVAPPPTPDPDPASHHTPARGLTVYK |
| Ga0210380_104522381 | 3300021082 | Groundwater Sediment | VEVTPDVDFARLQDVLVIVAPPPAPDPDPASHHTPGRGVAVFK |
| Ga0210388_100380491 | 3300021181 | Soil | DVDFARLSEVLVVVAPPPAPDADPAARRLPARGPMVYR |
| Ga0222622_113320171 | 3300022756 | Groundwater Sediment | PDVDFARLQDVLVVVAPPPVADPDPASHHTPGRGVAVIK |
| Ga0208357_11035061 | 3300025703 | Arctic Peat Soil | VTPDVDFSRLSEVLVVVAPPPAPDPDPSAHHLPARGLMVYK |
| Ga0207680_106286251 | 3300025903 | Switchgrass Rhizosphere | FARLTDVLVVVAPPPTPDPEPGSHHAPGRGLTVIK |
| Ga0207685_104060852 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RVIPGAVGLYQDVEVTPDVDFARLSEVLVVVAPPPAADTDPAARRLPARGPMVYR |
| Ga0207695_117454281 | 3300025913 | Corn Rhizosphere | GHITAVLPGAVGLFQDVEVTPDVDFARLSEVLVVAAPPPAPDPDAGAHRSSATPARGPMVYK |
| Ga0207662_101226821 | 3300025918 | Switchgrass Rhizosphere | VTPDVDFARLSEVLVVVAPPPSADPDAGTRRSFQPTPARGLSVYR |
| Ga0207657_107380611 | 3300025919 | Corn Rhizosphere | VGLYQDVEVTPDVDFARLTDVLVVVAPPPTPDPEPGSHHAPGRGLTVIK |
| Ga0207701_104109861 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | PGAVGLYQDVEVTPDVDFARLQDVLVIVAPPPAADPDPASHHRPARGLTVIK |
| Ga0207670_100760563 | 3300025936 | Switchgrass Rhizosphere | VEVTPDVDFARLTDVLVVVAPPPTPDPEPGSHHAPGRGLTVIK |
| Ga0207670_101278653 | 3300025936 | Switchgrass Rhizosphere | IPGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPTPDPEPGSHHTPGRGLAVMK |
| Ga0207670_108846462 | 3300025936 | Switchgrass Rhizosphere | VDFARLTDVLVVVAPPPTPDPEPGSHHAPGRGLTVIK |
| Ga0207691_110892171 | 3300025940 | Miscanthus Rhizosphere | EVTPDVDFARLTDVLVVVAPPPAPDPDPGSHHTPGRGMAVIK |
| Ga0207689_108265872 | 3300025942 | Miscanthus Rhizosphere | VEVTPDVDFARLSEVLVVVAPPPAADPEAGSRRTAPPARGLSVYR |
| Ga0207658_104740231 | 3300025986 | Switchgrass Rhizosphere | AVGLYQDVEVTPDVDFARLTDVLVIVAPPPAPDPEPSSHHTPGRGLTVIK |
| Ga0207677_111509011 | 3300026023 | Miscanthus Rhizosphere | GKVTKIIPGAVGLYQDVEVTPDVDFARLSDVLVVVAAPPAPDPDPSSHHLPARGLSVIK |
| Ga0207639_106484841 | 3300026041 | Corn Rhizosphere | LAIGHITHIFPGAVGLYQDVEVTPDVDFARLADVLVIVAPPPAADPDPGSHHLPARGLTVYR |
| Ga0207708_105847123 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | PGAVGLYQDVEVTPDVDFGRLSDVLVVVAPPPAADPEPSGHRQPARGLSVYK |
| Ga0207641_108950983 | 3300026088 | Switchgrass Rhizosphere | GLYQDVEVTPDVDFARLTDVLVIVAPPPAPDPEPSSHHTPGRGLTVIK |
| Ga0207641_116561512 | 3300026088 | Switchgrass Rhizosphere | VEVTPDVDFARLTDVLVVVAPPPAPDPDPASHHTPARGLTVFK |
| Ga0207641_118855321 | 3300026088 | Switchgrass Rhizosphere | PGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPAADPDPGSHHTPGRGLAVIK |
| Ga0207641_119652852 | 3300026088 | Switchgrass Rhizosphere | DVDFARLTDVLVVVAPPPAPDPDPGSHHTPGRGLAVIK |
| Ga0207676_108338351 | 3300026095 | Switchgrass Rhizosphere | NLAVGHIARIIPGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPAPDPDPGSHHTPGRGMAVIK |
| Ga0207674_118804611 | 3300026116 | Corn Rhizosphere | VTRIIPGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPAPDPDPGSHHTPGRGLTVFK |
| Ga0207675_1006386541 | 3300026118 | Switchgrass Rhizosphere | GAVGLYQDVEVAPDVDFARLTDVLVVVAPPPVPDPDPGSHHTPGRGLTVFK |
| Ga0207698_106637961 | 3300026142 | Corn Rhizosphere | DVDFARLTDVLVIVAPPPAPDPEPASHHAPGRGLTVIK |
| Ga0207698_126882962 | 3300026142 | Corn Rhizosphere | AVGHITRVIPGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPTPDPEPGSHHAPGRGLTVI |
| Ga0209849_10772301 | 3300026215 | Soil | GAVGLYQDVEVTPDVDFGRLSEVLVVVAPPPAPDPDPGAHHLPARGLMVYK |
| Ga0247662_10453722 | 3300028293 | Soil | VEVTPDVDFARLTDVLVVVAPPPAADPEPASHHTPGRGLTVIK |
| Ga0268266_114912122 | 3300028379 | Switchgrass Rhizosphere | DFARLTDVLVIVAPPPAPDPDPGSHHTPGRGMAVIK |
| Ga0265334_101112143 | 3300028573 | Rhizosphere | DVDFARLSEVLVVVAPPPAPDTDPAARRLPARGPMVYR |
| Ga0265328_104065892 | 3300031239 | Rhizosphere | EVTPDVDFARLSEVLVVVAPPPSADPEPGPRRSSLPTRGLSVYR |
| Ga0265339_103766101 | 3300031249 | Rhizosphere | EVTPDVDFARLSEVLVVVAPPPAPDTDPAARRLPARGPMVYR |
| Ga0265316_100859181 | 3300031344 | Rhizosphere | TAVLPGAVGLFQDVEVTPDVDFARLSEVLVVAAPPPAADPDAGSKRAGAVPARGPMVYK |
| Ga0311364_112707482 | 3300031521 | Fen | PDVDFARLSEVLVVVAPPPAPDTDPAARRLPARGPMVYR |
| Ga0310888_100761443 | 3300031538 | Soil | LYQDVEVTPDVDFARLTDVLVVVAPPPTPDPEPGSHHAPGRGLTVIK |
| Ga0318528_102292701 | 3300031561 | Soil | PGAVGLYQDVEVTPDVDFGRLADVLVVVAPPPAPDPEAGSHHQPARGLMVYR |
| Ga0318528_104553711 | 3300031561 | Soil | VGLYQDVEVTPDVDFARLSEVLVVVAPPPAPDTDPAARRLPARGPMVYR |
| Ga0318555_100316073 | 3300031640 | Soil | IPGAVGLYQDVEVTPDVDFGRLADVLVVVAPPPAPDPEAGSHHQPARGLMVYR |
| Ga0265314_100194786 | 3300031711 | Rhizosphere | DVDFARLSEVLVVVAPPPSADPDAGSRRASPPGRGLSVYR |
| Ga0302321_1000559231 | 3300031726 | Fen | FARLSEVLVVVAPAPPADPEASAHKSLVPSHGLGVYR |
| Ga0318494_101434713 | 3300031751 | Soil | DVDFGRLADVLVVVAPPPAPDPEAGSHHQPARGLMVYR |
| Ga0318503_100113103 | 3300031794 | Soil | VDFGRLADVLVVVAPPPAPDPEAGSHHQPARGLMVYR |
| Ga0318568_102395853 | 3300031819 | Soil | LAVGHVTKVIPGAVGLYQDVEVTPDVDFGRLADVLVVVAPPPAPDPEAGSHHQPARGLMVYR |
| Ga0318517_104061412 | 3300031835 | Soil | TKVIPGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPAPDPDPGAHHLPAHGLSVYR |
| Ga0318495_103569832 | 3300031860 | Soil | TKVIPGAVGLYQDVEVTPDVDFGRLADVLVVVAPPPAPDPEAGSHHQPARGLMVYR |
| Ga0302322_1018939241 | 3300031902 | Fen | DFARLSEVLIVVAPAPPVDPDAGSKKPLVPAHGLAVYR |
| Ga0308174_107838081 | 3300031939 | Soil | TPDVDFARLSEVLVVVAPPPAPDTDPAARRLPARGPMVYR |
| Ga0310885_103847152 | 3300031943 | Soil | ITRVIPGAVGLYQDVEVTPDVDFARLTDVLVVVAPPPTPDPEPGSHHAPGRGLTVIK |
| Ga0318530_103066452 | 3300031959 | Soil | KVIPGAVGLYQDVEVTPDVDFGRLADVLVVVAPPPAPDPEAGSHHQPARGLMVYR |
| Ga0307416_1022188311 | 3300032002 | Rhizosphere | VTPDVDFARLSDVLVVVAPPPAQDPDPGGHRQPSRGMSVYK |
| Ga0318540_104428821 | 3300032094 | Soil | GDDGVPFSRNLAVGHVTKVIPGAVGLYQDVEVTPDVDFGRLADVLVVVAPPPAPDPEAGSHHQPARGLMVYR |
| Ga0306920_1008291463 | 3300032261 | Soil | LYQDVEVTPDVDFARLADVLVVVAPPPAPDPEAGSHHQPARGLMVYR |
| ⦗Top⦘ |