


| Basic Information | |
|---|---|
| Family ID | F098055 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MRSACDEETPHCNWCERPMTEEEHDFCDICDECREENELD |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 20.19 % |
| % of genes near scaffold ends (potentially truncated) | 31.73 % |
| % of genes from short scaffolds (< 2000 bps) | 65.38 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.885 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (50.962 % of family members) |
| Environment Ontology (ENVO) | Unclassified (88.462 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.423 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.12% β-sheet: 2.94% Coil/Unstructured: 77.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF01068 | DNA_ligase_A_M | 10.58 |
| PF04545 | Sigma70_r4 | 8.65 |
| PF02562 | PhoH | 5.77 |
| PF04404 | ERF | 5.77 |
| PF08279 | HTH_11 | 0.96 |
| PF14743 | DNA_ligase_OB_2 | 0.96 |
| PF04542 | Sigma70_r2 | 0.96 |
| PF12116 | SpoIIID | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 10.58 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 10.58 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 5.77 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 5.77 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.96 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.96 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.96 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.88 % |
| All Organisms | root | All Organisms | 47.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 50.96% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 17.31% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.73% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.81% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.88% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.88% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.92% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.92% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.92% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.92% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.96% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.96% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.96% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.96% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.96% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005821 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
| 3300007900 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf. Combined Assembly of MM1PM1 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100275453 | 3300000115 | Marine | MSRTACDAETPHCEFCERPMTTIEYEFCDICDECREENELD* |
| DelMOSum2011_100527512 | 3300000115 | Marine | MITECDAETPHCNWCERPMTTIEHEFCDICDECREENELD* |
| BBAY92_100243003 | 3300000947 | Macroalgal Surface | MMSACDMETPHCNWCERPMTEEDHDFCDICDDCREENELD* |
| JGI24005J15628_100479482 | 3300001589 | Marine | VRSACDAATPHCEWCERTMTEEEHDFCDICDQCREENEID* |
| JGI24005J15628_101716061 | 3300001589 | Marine | MKMVRTACDAETPHCEWCERTMTEEDHDFCDICDECREENEID* |
| Ga0065861_10046055 | 3300004448 | Marine | MRSACDEVTPHCEWCERPMTTIEHEFCDICDECREENEID* |
| Ga0078746_10150984 | 3300005821 | Marine Sediment | MNEIRTKCDAETPHCEWCERPMTEEEHDFCDICDECREENELD* |
| Ga0078893_110932072 | 3300005837 | Marine Surface Water | MSRTACDAETPHCNWCERPMTEEEHDFCDICDECREENDGYE* |
| Ga0075441_101557292 | 3300006164 | Marine | MRSACDEETPQCNLCERPMTEEEHDFCDICDECREENDLLL* |
| Ga0075441_102618822 | 3300006164 | Marine | MTKTELPKCNWCERPMTEEEHDFCDICDECREENDLLL* |
| Ga0098038_10138258 | 3300006735 | Marine | MITVCDAETPHCNWCERPMTEEEHDFCDICDECREENELD* |
| Ga0098038_10163243 | 3300006735 | Marine | MSRTAYDEETPQCPWCERPMTIIEHEFCEICDECREENELD* |
| Ga0098038_12258762 | 3300006735 | Marine | MVQKEQPRSILRIIRLMRSACDEETPHCEWCERPMTEEEHDFCDICDECREENEID* |
| Ga0098037_10221611 | 3300006737 | Marine | VCDAETPHCNWCERPMTEEEHDFCDICDECREENELD* |
| Ga0098048_100354811 | 3300006752 | Marine | MRSACDEETPHCEFCERPMTVIEHEFCDICDECREENELN* |
| Ga0098048_11282754 | 3300006752 | Marine | MRSACDEETPHCEFCEKPMTVIEHEFCDICDECREENELN* |
| Ga0098054_10066541 | 3300006789 | Marine | SACDEETPHCEFCERPMTVIEHEFCDICDECREENELN* |
| Ga0098054_10129799 | 3300006789 | Marine | CDEETPHCEFCERPMTVIEHEFCDICDECREENEID* |
| Ga0098055_10099094 | 3300006793 | Marine | MRSACDEETPHCEFCERPMTVIEHEFCDICDECREENEID* |
| Ga0098055_10582451 | 3300006793 | Marine | RLMRSACDEETPHCEFCERPMTVIEHEFCDICDECREENELN* |
| Ga0098055_11241293 | 3300006793 | Marine | MCIAYEEETPKCEFCEKPMTVIDHEFCDICDECREENELD* |
| Ga0098055_11371993 | 3300006793 | Marine | MRSACDSKTPHCEWCERPMTEEEHDFCDICGECREENEID* |
| Ga0098055_13104351 | 3300006793 | Marine | MRSACDEETPHCNWCERPMTEEEHDFCDICDECREENELD* |
| Ga0070749_102441582 | 3300006802 | Aqueous | MSRTACDAETPHCEFCERPMTTIEYEFCDICDECREENELDYE* |
| Ga0070746_101354835 | 3300006919 | Aqueous | SVLRITRLMRSACDKETPHCNWCERPMTEEEHDFCDICDECREENELD* |
| Ga0070746_101528761 | 3300006919 | Aqueous | MSRTACDAETPHCEFCERPMTTIEYEFCDICDECREENEL |
| Ga0070748_10087073 | 3300006920 | Aqueous | MSRTAYDEETPHCPWCERPMTIIEHEFCEICDECREENELD* |
| Ga0098060_10279902 | 3300006921 | Marine | MRGACDEETPHCEFCERPMTVIEHEFCDICDECREENEID* |
| Ga0098045_11105611 | 3300006922 | Marine | MRSACDEETPHCEFCERPMTVIEHEFCDICDECREENE |
| Ga0098051_10152535 | 3300006924 | Marine | MRSACDEETPHCNWCERPMTEEEHNFCDICDECREENEID* |
| Ga0098051_10861241 | 3300006924 | Marine | MRSACDAETPHCEWCERPMTEEEHDFCDICGECREENEID* |
| Ga0098050_10769002 | 3300006925 | Marine | MSRTACDAETPHCEFCERPMTTIEHEFCDICDECREENEL* |
| Ga0098050_10879633 | 3300006925 | Marine | TRLMRSACDEETPHCEWCERPMTEEEHDFCDICDECREENELD* |
| Ga0098036_12010502 | 3300006929 | Marine | YLKQYEIMSRTACDAETPHCEFCERPMTTIEYEFCDICDECREENELD* |
| Ga0098046_10501654 | 3300006990 | Marine | MRSACDSETPHCNWCERPMTEEEHDFCDICDECREENELD* |
| Ga0070745_10208588 | 3300007344 | Aqueous | MSRTACDAETPRCEFCERPMTTIEYEFCDICDECREENELDYE* |
| Ga0102824_10795972 | 3300007681 | Estuarine | MSRTACDAETPHCEFCERPMTIIEHEFCDICDECREENEL* |
| Ga0111031_10018253 | 3300007900 | Marine Sediment | MRSACDTATPHCEWCEKTMTEEDHDFCDICDECREENEID* |
| Ga0105746_12996761 | 3300007973 | Estuary Water | MSRTACDAETPHCEWCERTMTEEDHDFCDICDECREENEID* |
| Ga0114910_10566401 | 3300008220 | Deep Ocean | RTACDAETPHCEWCERPMTEEDHDFCDICDECREENELD* |
| Ga0102812_102582584 | 3300009086 | Estuarine | MRSACDEETPHCNWCERPMTEEEHDFCDICDECREENELDY |
| Ga0114995_100089485 | 3300009172 | Marine | MRSACDEVTPHCEWCERTMTEEEHDFCDICDECREDNEID* |
| Ga0115545_10540355 | 3300009433 | Pelagic Marine | CDAKTPHCEWCERPMTEEDHDFCDICDECREENDEYK* |
| Ga0115567_109704271 | 3300009508 | Pelagic Marine | RRIFRIIRLMRSACDAETPHCNWCERPMTEEEHGFCDICDECREENELD* |
| Ga0098049_10494821 | 3300010149 | Marine | ITRLMRSACDEETPHCEFCERPMTVIEHEFCDICDECREENELN* |
| Ga0133547_109323614 | 3300010883 | Marine | MSRTACDAQTPHCEWCERTMTEEDHDFCDICDECREENEID* |
| Ga0181377_10094483 | 3300017706 | Marine | MRSACDAETLHCNWCERPMTEEEHDFCDICDECREENELD |
| Ga0181377_10508052 | 3300017706 | Marine | MSRTACDAETPHCEFCERPMTVIEHEFCDICDECREENEL |
| Ga0181377_10530032 | 3300017706 | Marine | MSRTLCDAETPHCNWCERPMTEEEHDFCDICDECREENDGYE |
| Ga0181391_100134311 | 3300017713 | Seawater | MRSACDEETPHCPWCERPMTIIEHEFCEICDECREENELN |
| Ga0181404_10647831 | 3300017717 | Seawater | SRTACDAQTPHCEWCERTMTEEDHDFCDICDECREENEID |
| Ga0181390_100055228 | 3300017719 | Seawater | MRSACDEETPHCPWCERPMTIIEHEFCEICDECREENELD |
| Ga0181383_10357921 | 3300017720 | Seawater | MSRTAYDEETPHCPWCERPMTIIEHEFCEICDECREENEL |
| Ga0181381_10148683 | 3300017726 | Seawater | MSRTACDAETPHCNWCERPMTEEEHDFCDICDECREENELD |
| Ga0181427_10597192 | 3300017745 | Seawater | MSRTACDAETPHCEWCERPMTEEDHDFCDICDECREENELD |
| Ga0181389_10161026 | 3300017746 | Seawater | TIMKMVRTECDAQTPHCEFCERPMTTIEHEFCDICDECREENEID |
| Ga0181392_100688110 | 3300017749 | Seawater | DEETPHCEFCERPMTVIEHEFCDICDECREENELN |
| Ga0181382_10298795 | 3300017756 | Seawater | MRSACDEETPHCPWCERPMTIIEHEFCEICDECRE |
| Ga0181414_10978433 | 3300017759 | Seawater | CDAQTPHCEWCERTMTEEDHDFCDICDECREENEEYE |
| Ga0181422_11470712 | 3300017762 | Seawater | MRSACDAETPHCNWCERPMTTIEHEFCDICDECREENEID |
| Ga0181430_11256542 | 3300017772 | Seawater | SKQYETMSRTACDAETPHCEWCERTMTEEDHDFCDICDECREENEID |
| Ga0181394_10347181 | 3300017776 | Seawater | YEETPHCPWCERPMTIIEHEFCEICDECREENELN |
| Ga0181395_10863072 | 3300017779 | Seawater | MSRTACDAETPHCEFCERPMTTIEHEFCDICDECREENE |
| Ga0181424_101489292 | 3300017786 | Seawater | MRSACDAETPHCEWCERTMTEEDHDFCDICDECREENEID |
| Ga0211504_10132985 | 3300020347 | Marine | MSRTACDAETPHCEFCERPMTTIEHEFCDICDECREENEL |
| (restricted) Ga0233412_100440574 | 3300023210 | Seawater | MRSACDTATPHCEWCEKTMTEEDHDFCDICDECREENEID |
| (restricted) Ga0255040_101853622 | 3300024059 | Seawater | MRSACDAETPHCEFCERPMTTIEYEFCDICDECREENEID |
| (restricted) Ga0255039_101950052 | 3300024062 | Seawater | MRSACDAATPHCEWCERTMTEEEHDFCDICDECREENEID |
| Ga0244775_112794962 | 3300024346 | Estuarine | MRSACDEETPHCNWCERPMTEEEHDFCDICDECREENELD |
| (restricted) Ga0255048_100370288 | 3300024518 | Seawater | MEQEVLKCEFCNKPMTQEDHEFCDICGDCRDENAWDIK |
| (restricted) Ga0255044_104775842 | 3300024529 | Seawater | MRSACDAATPHCEFCERPMTTIEHEFCDICDECREDNEID |
| Ga0208667_10045003 | 3300025070 | Marine | MRSACDEETPHCEFCERPMTVIEHEFCDICDECREENELN |
| Ga0208667_10552643 | 3300025070 | Marine | MCIAYEEETPKCEFCEKPMTVIDHEFCDICDECREENELD |
| Ga0207896_10104653 | 3300025071 | Marine | MSRTVCDAETPHCEWCERTMTEEDHDFCDICDECREENEID |
| Ga0208791_10097593 | 3300025083 | Marine | MRSACDEETPHCEFCERPMTVIEHEFCDICDECREENELNGHL |
| Ga0208298_100080017 | 3300025084 | Marine | MRSACDEETPHCNWCERPMTEEEHDFCDICDECREENEID |
| Ga0208298_10101456 | 3300025084 | Marine | MRSACDEETPHCEFCERPMTVIEHEFCDICDECREENEID |
| Ga0208298_10740891 | 3300025084 | Marine | RLMRSACDEETPHCEFCERPMTVIEHEFCDICDECREENELN |
| Ga0208792_10032491 | 3300025085 | Marine | CDSKTPHCEWCERPMTEEEHDFCDICGECREENEID |
| Ga0208792_100366412 | 3300025085 | Marine | MRSACDEETPHCNWCERPMTEEEHDFCDICGECREENEID |
| Ga0208157_10053409 | 3300025086 | Marine | MITVCDAETPHCNWCERPMTEEEHDFCDICDECREENELD |
| Ga0208434_10091061 | 3300025098 | Marine | LCSKQYETMSRTACDAETPHCNWCERPMTEEEHDFCDICDECREENELD |
| Ga0208666_10024701 | 3300025102 | Marine | ITVCDAETPHCNWCERPMTEEEHDFCDICDECREENELD |
| Ga0208013_10285121 | 3300025103 | Marine | ACDEETPHCEFCERPMTVIEHEFCDICDECREENEID |
| Ga0208793_100344511 | 3300025108 | Marine | MRSACDSKTPHCEWCERPMTEEEHDFCDICGECREENEID |
| Ga0208793_10299621 | 3300025108 | Marine | ILRVTRLMRSACDEETPHCEFCERPMTVIEHEFCDICDECREENELN |
| Ga0209349_10786952 | 3300025112 | Marine | MSRTACDAVTPHCEFCERPMTTIEHEFCDICDECREENEEYE |
| Ga0209336_101574042 | 3300025137 | Marine | MSRTVCDAETPHCEWCEKTMTEEDHDFCDICDDCREENEID |
| Ga0209634_10285129 | 3300025138 | Marine | MRSACDEVTPHCNWCERPMTTIEHEFCDICDECREENEID |
| Ga0209634_10308496 | 3300025138 | Marine | MRSACDEVTPHCNWCERPMTEEEHDFCDICDECREENDVLL |
| Ga0209645_11049262 | 3300025151 | Marine | MSRTACDAETPHCEFCERPMTTIEYEFCDICDECREENELD |
| Ga0209337_10843595 | 3300025168 | Marine | DAETPHCEWCERTMTEEDHDFCDICDECREENEID |
| Ga0209337_11220962 | 3300025168 | Marine | MSRTACDAETPHCEWCERTMTEEDHDFCDICDECREENEID |
| Ga0209337_12365521 | 3300025168 | Marine | TACDAETPHCEWCERTMTEEDHDFCDICDECREENEID |
| Ga0208814_11164812 | 3300025276 | Deep Ocean | MRSACDEETPQCNLCERPMTEEEHDFCDICDECREENDLLL |
| Ga0208162_11789562 | 3300025674 | Aqueous | MSRTACDAETPHCEFCERPMTTIEYEFCDICDECREENELDYE |
| Ga0208767_10154809 | 3300025769 | Aqueous | MSRTAYDEETPHCPWCERPMTIIEHEFCEICDECREENELD |
| Ga0209603_13198582 | 3300025849 | Pelagic Marine | RTECDAKTPHCEWCERPMTEEDHDFCDICDECREENELD |
| Ga0209384_11065852 | 3300027522 | Marine | MTKTELPKCNWCERPMTEEEHDFCDICDECREENDLLL |
| Ga0209192_100221334 | 3300027752 | Marine | MRSACDEVTPHCEWCERTMTEEEHDFCDICDECREDNEID |
| (restricted) Ga0233415_102580962 | 3300027861 | Seawater | MSRTACDAATPHCEFCERPMTTIEHEFCDICDECREENELDYE |
| Ga0183757_10496982 | 3300029787 | Marine | MSRTACDAETPHCEWCERPMTEEDHDFCEICDECREENELD |
| Ga0307488_100887371 | 3300031519 | Sackhole Brine | VCDAETPHCEWCERTMTEEDHDFCDICDECREENEID |
| Ga0307379_101362016 | 3300031565 | Soil | MRSACDEETPHCEFCERPMTTIEHEFCDICDECREENELD |
| ⦗Top⦘ |