


| Basic Information | |
|---|---|
| Family ID | F097980 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 38 residues |
| Representative Sequence | VGARNAKQAEGVMRAGELKLTIEEIAEIEGAAAAATAR |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.04 % |
| % of genes from short scaffolds (< 2000 bps) | 92.31 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.769 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.808 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.115 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.91% β-sheet: 0.00% Coil/Unstructured: 59.09% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00106 | adh_short | 56.73 |
| PF04248 | NTP_transf_9 | 7.69 |
| PF13561 | adh_short_C2 | 5.77 |
| PF01979 | Amidohydro_1 | 5.77 |
| PF04519 | Bactofilin | 2.88 |
| PF00248 | Aldo_ket_red | 1.92 |
| PF01925 | TauE | 0.96 |
| PF13180 | PDZ_2 | 0.96 |
| PF14833 | NAD_binding_11 | 0.96 |
| PF07681 | DoxX | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 7.69 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 2.88 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.96 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.96 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.77 % |
| Unclassified | root | N/A | 19.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c1210583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5126 | Open in IMG/M |
| 3300001593|JGI12635J15846_10217473 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100119881 | All Organisms → cellular organisms → Bacteria | 2476 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101137918 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300004091|Ga0062387_101694654 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300004152|Ga0062386_100273930 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300004633|Ga0066395_10508999 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300005439|Ga0070711_100941270 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300005537|Ga0070730_10534150 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005587|Ga0066654_10882894 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005591|Ga0070761_10022648 | All Organisms → cellular organisms → Bacteria | 3502 | Open in IMG/M |
| 3300005602|Ga0070762_10545225 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300005764|Ga0066903_108139418 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005993|Ga0080027_10098953 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300006172|Ga0075018_10215073 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300006172|Ga0075018_10718758 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006176|Ga0070765_101083231 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300006796|Ga0066665_10658927 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300006881|Ga0068865_101276216 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300006904|Ga0075424_101117256 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300007076|Ga0075435_102064710 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300007788|Ga0099795_10128420 | Not Available | 1020 | Open in IMG/M |
| 3300009137|Ga0066709_104331837 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300009792|Ga0126374_10223610 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300010043|Ga0126380_10888769 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300010326|Ga0134065_10045123 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300010336|Ga0134071_10523392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Cronobacter → Cronobacter sakazakii | 614 | Open in IMG/M |
| 3300010358|Ga0126370_10427576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1097 | Open in IMG/M |
| 3300010400|Ga0134122_10718011 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300011269|Ga0137392_11261278 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300011269|Ga0137392_11350477 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012096|Ga0137389_10525855 | Not Available | 1015 | Open in IMG/M |
| 3300012181|Ga0153922_1098306 | Not Available | 665 | Open in IMG/M |
| 3300012202|Ga0137363_11490423 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012203|Ga0137399_10020832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4289 | Open in IMG/M |
| 3300012203|Ga0137399_10202147 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300012203|Ga0137399_10689371 | Not Available | 860 | Open in IMG/M |
| 3300012203|Ga0137399_11104394 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300012205|Ga0137362_10682772 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300012205|Ga0137362_11391041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300012208|Ga0137376_10582808 | Not Available | 968 | Open in IMG/M |
| 3300012285|Ga0137370_10595455 | Not Available | 683 | Open in IMG/M |
| 3300012357|Ga0137384_10761052 | Not Available | 785 | Open in IMG/M |
| 3300012685|Ga0137397_10322999 | Not Available | 1150 | Open in IMG/M |
| 3300012918|Ga0137396_10044327 | All Organisms → cellular organisms → Bacteria | 3021 | Open in IMG/M |
| 3300012918|Ga0137396_10449370 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300012923|Ga0137359_10054168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3489 | Open in IMG/M |
| 3300012924|Ga0137413_11109264 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300012930|Ga0137407_12265534 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300012931|Ga0153915_13257279 | Not Available | 527 | Open in IMG/M |
| 3300013308|Ga0157375_13551836 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300013832|Ga0120132_1053354 | Not Available | 787 | Open in IMG/M |
| 3300014056|Ga0120125_1008373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2129 | Open in IMG/M |
| 3300014150|Ga0134081_10315868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300014157|Ga0134078_10127420 | Not Available | 980 | Open in IMG/M |
| 3300014502|Ga0182021_13652645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300015053|Ga0137405_1151197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1362 | Open in IMG/M |
| 3300015242|Ga0137412_10452163 | Not Available | 988 | Open in IMG/M |
| 3300015242|Ga0137412_10728447 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300016294|Ga0182041_10044050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2971 | Open in IMG/M |
| 3300016445|Ga0182038_11758288 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300018058|Ga0187766_10724360 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300018086|Ga0187769_10985293 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300018468|Ga0066662_11995988 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300019882|Ga0193713_1066799 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300020199|Ga0179592_10235559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300021170|Ga0210400_10386123 | Not Available | 1154 | Open in IMG/M |
| 3300021171|Ga0210405_11066696 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300021178|Ga0210408_10310270 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300021178|Ga0210408_11126312 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300021178|Ga0210408_11468404 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300021432|Ga0210384_10669047 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300021432|Ga0210384_11548564 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300021474|Ga0210390_11631490 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300021478|Ga0210402_11303485 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300021479|Ga0210410_10784559 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300025938|Ga0207704_11166951 | Not Available | 656 | Open in IMG/M |
| 3300026481|Ga0257155_1070212 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300026557|Ga0179587_10382872 | Not Available | 915 | Open in IMG/M |
| 3300027537|Ga0209419_1036116 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300027643|Ga0209076_1135078 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300027783|Ga0209448_10185738 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300027846|Ga0209180_10720084 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300027855|Ga0209693_10209166 | Not Available | 959 | Open in IMG/M |
| 3300027867|Ga0209167_10785625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300027875|Ga0209283_10428577 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300027875|Ga0209283_10572763 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300027903|Ga0209488_10233725 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300028536|Ga0137415_10669214 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300029636|Ga0222749_10427155 | Not Available | 706 | Open in IMG/M |
| 3300029636|Ga0222749_10718407 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031057|Ga0170834_113916474 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300031715|Ga0307476_10924279 | Not Available | 643 | Open in IMG/M |
| 3300031724|Ga0318500_10559699 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300031833|Ga0310917_10211757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1298 | Open in IMG/M |
| 3300032008|Ga0318562_10323203 | Not Available | 897 | Open in IMG/M |
| 3300032009|Ga0318563_10479029 | Not Available | 673 | Open in IMG/M |
| 3300032180|Ga0307471_100530157 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300032205|Ga0307472_100584381 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300032205|Ga0307472_101917508 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300032205|Ga0307472_101992293 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300032770|Ga0335085_11966232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300032828|Ga0335080_10863653 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300033547|Ga0316212_1032575 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.35% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.92% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.96% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_12105831 | 2228664022 | Soil | RNAGQAEGVMRAGELKLSAEEIAEIEGAAAAATAR |
| JGI12635J15846_102174733 | 3300001593 | Forest Soil | RNAKQAEGVMRAGELKLSADEIAEIEGAAAVATAR* |
| JGIcombinedJ26739_1001198816 | 3300002245 | Forest Soil | AIVGARNAQQAEEVMRAGEIKLNAQDIAEIEGTASAQVAR* |
| JGIcombinedJ26739_1011379182 | 3300002245 | Forest Soil | GVIVGARNAKQVEGVVGAADVTLTKQDIAEIEGAAAIAATR* |
| Ga0062387_1016946541 | 3300004091 | Bog Forest Soil | GAIVGARNAKQAEGVMHAGELKLTPQDLAEIEGTASAIAAR* |
| Ga0062386_1002739303 | 3300004152 | Bog Forest Soil | TGAIVGARNAKQAEGVMHAGELKLTPQDLAEIEGTAAAIAAR* |
| Ga0066395_105089993 | 3300004633 | Tropical Forest Soil | IVGARNAQQAEGVMRAGELKLSVEDITEIEAAAAVATAR* |
| Ga0070711_1009412702 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | IVGARNAKQAEGVMRAGELKLTTEEMAEIEGAAATATAR* |
| Ga0070730_105341502 | 3300005537 | Surface Soil | AIVGSRSAKQAEGVMRAGELKLTDQDIAQIEGKAAAMAVR* |
| Ga0066654_108828941 | 3300005587 | Soil | VGARNAKQVDGVMRAGELKLTSEEIAEIEGAAVAATAS* |
| Ga0070761_100226487 | 3300005591 | Soil | RNAKQAEGVMRAGELKLTPQDLAEIEGSAAAMAVR* |
| Ga0070762_105452252 | 3300005602 | Soil | RNAKQAEGVMRAGELKLAPEEIMEIEGAAAVAAAR* |
| Ga0066903_1081394182 | 3300005764 | Tropical Forest Soil | RNAKQAEGAMRAGELRLSPEEIVEIEGAAAAATAR* |
| Ga0080027_100989531 | 3300005993 | Prmafrost Soil | NAKQAEGVMRAADLKLTKQEIDEIEGAAAIAVAR* |
| Ga0075018_102150731 | 3300006172 | Watersheds | AIVGARNAKQSASIMRAGDLKLSTEEITEIEAAAASATAR* |
| Ga0075018_107187582 | 3300006172 | Watersheds | RNAKQSEGVMRAGELKLTAEEIAEIEGAAAAATAR* |
| Ga0070765_1010832311 | 3300006176 | Soil | RNAKQADGVMRAGELKLTPEEITEIEGAAAVAVAR* |
| Ga0066665_106589273 | 3300006796 | Soil | GARNAKQAEGVMRAGELKLTTDEIAEIEGAAAVATAR* |
| Ga0068865_1012762161 | 3300006881 | Miscanthus Rhizosphere | NAKQADGVMRAGELKLSQDEIAEIEGAAAAATAH* |
| Ga0075424_1011172561 | 3300006904 | Populus Rhizosphere | GARNAKQAEGVMRAGELKLSQAEITEIEGAAAAATAHS* |
| Ga0075435_1020647101 | 3300007076 | Populus Rhizosphere | IVGARNAKQADGVMRAAEIKLSKEDIAEIEGAAAAVAR* |
| Ga0099795_101284201 | 3300007788 | Vadose Zone Soil | NADQAEEVMRAGEIKLTAQDIAEIEGTAAAQVAR* |
| Ga0066709_1043318371 | 3300009137 | Grasslands Soil | RNAKQAEGVMRAGEMKLTADEIAEIEGAAAVATAR* |
| Ga0126374_102236103 | 3300009792 | Tropical Forest Soil | GAIVGARDAKQADGVMRAGGLKLSAEEIVEIEGAAAAAVAR* |
| Ga0126380_108887691 | 3300010043 | Tropical Forest Soil | GAIVGARNAQQAEGVMRAGELKLSVEDITEIEAAAAVATAR* |
| Ga0134065_100451231 | 3300010326 | Grasslands Soil | NAMQSEGVMRAAELKLSAEEIGEIEGAAAAATAR* |
| Ga0134071_105233922 | 3300010336 | Grasslands Soil | GARNAKQAEGVMRAGELKLTIEEIAEIEGAAAAATAR* |
| Ga0126370_104275761 | 3300010358 | Tropical Forest Soil | GAIVGARNAKQAEEIMRAGEVKLSPEEIAEIEDAAAAATVR* |
| Ga0134122_107180112 | 3300010400 | Terrestrial Soil | AIVGARNAKQAGSVMRAGELQLSQEEITEIEGAAAAATAR* |
| Ga0137392_112612781 | 3300011269 | Vadose Zone Soil | TGAIVGARNAKQAEGVMRAGELKLSPEEIAGIEGAAAAATATAR* |
| Ga0137392_113504771 | 3300011269 | Vadose Zone Soil | AIVGARNAKQAEGVMRAGELKLTAEEIAEIEGAAAAATAR* |
| Ga0137389_105258551 | 3300012096 | Vadose Zone Soil | IVGARNANQAEGVMRAGELKLTPQDFAEIEGTVAQVAR* |
| Ga0153922_10983061 | 3300012181 | Attine Ant Fungus Gardens | RNARQAEGVMRAGELKLTPQDIAEIEGTAAAHAGR* |
| Ga0137363_114904231 | 3300012202 | Vadose Zone Soil | IVGARNAKQAEGVMRAGDLKLTPSDIAEIEGTTAKAAP* |
| Ga0137399_100208327 | 3300012203 | Vadose Zone Soil | VTGAIVGARNAKQAEGVMCAGELKLTTEEIAEIEGAAALATAR* |
| Ga0137399_102021471 | 3300012203 | Vadose Zone Soil | RNAKQSEGVMRAGGLKLSANEIAEIEGAAALATAR* |
| Ga0137399_106893711 | 3300012203 | Vadose Zone Soil | RNAKQVDGVMGATDLKLSQEEISEIEGAAAAVAR* |
| Ga0137399_111043942 | 3300012203 | Vadose Zone Soil | ITGAIVGARNAKQSEGVMRAGEVQLTRDEIAEIEGAAAVATAR* |
| Ga0137362_106827721 | 3300012205 | Vadose Zone Soil | IVGARNAKQAEGVMRAADLRLSEEDVADIESETRIAA* |
| Ga0137362_113910412 | 3300012205 | Vadose Zone Soil | LSVLNAKQSEGVMRAGELKLSPEEIAEIEGAAAAAATR* |
| Ga0137376_105828082 | 3300012208 | Vadose Zone Soil | AIVGARNAKQAEGVMRAGELKLTAQEIAEIEGAAAVATAR* |
| Ga0137370_105954551 | 3300012285 | Vadose Zone Soil | RNARQAEGVMRAGELKLTAEEIAEIEGAAAASAG* |
| Ga0137384_107610521 | 3300012357 | Vadose Zone Soil | GARNAKQAEGVMRAGELKLTPEEITEIEGAATAATAR* |
| Ga0137397_103229993 | 3300012685 | Vadose Zone Soil | GARNAQQAEEVMRAGEIKLTPQDIAEIEGTAAAQVAR* |
| Ga0137396_100443275 | 3300012918 | Vadose Zone Soil | VTGAIVGARNAKQAEEVMRAGDIKLSPQDVAEIEGVATQVAR* |
| Ga0137396_104493701 | 3300012918 | Vadose Zone Soil | NAKQAKGVMRAGELKLTADEIAEIEGAAALATAR* |
| Ga0137359_100541681 | 3300012923 | Vadose Zone Soil | IVGARNAKQSEGVMRAGELKLTSEEIVEIEGAAAAAAAR* |
| Ga0137413_111092642 | 3300012924 | Vadose Zone Soil | AIVGARNAKQAQGVMRAGEMKLTSQDLAEIDGTVAAQVAR* |
| Ga0137407_122655341 | 3300012930 | Vadose Zone Soil | VGARNAQQAEEVMRAGEIKLTPQDIAEIEATAAAQVAR* |
| Ga0153915_132572792 | 3300012931 | Freshwater Wetlands | LVTAAIVGARSEMQAEGVMRAAELRLSEDEIAEIEGA* |
| Ga0157375_135518362 | 3300013308 | Miscanthus Rhizosphere | TGAIVGARNAKQAGSVMRAGELQLSQEEITEIEGAAAAATAR* |
| Ga0120132_10533542 | 3300013832 | Permafrost | VGARNAKQAEGVMRAGDLKLTKQEIAEIEGAAATATAR* |
| Ga0120125_10083731 | 3300014056 | Permafrost | NARQAEGVMRAGELELTPQDIAEIEGTAAAHAGR* |
| Ga0134081_103158682 | 3300014150 | Grasslands Soil | RNARQVEGVMRAGELKLTPGEIAEIEGAAVAAGSR* |
| Ga0134078_101274202 | 3300014157 | Grasslands Soil | RNAKQVEGVMRAGEWKLNAGEIAEIEGAAVIAASR* |
| Ga0182021_136526452 | 3300014502 | Fen | GARNAKQAEGVMTAGELRLTEEEVNEIESEAAVAA* |
| Ga0137405_11511973 | 3300015053 | Vadose Zone Soil | VGARNAKQAEGVMRAGELKLTIEEIAEIEGAAAAATAR* |
| Ga0137412_104521631 | 3300015242 | Vadose Zone Soil | AIVGARNAKQAQGVMRAGEMKLTSQDLAEIEGTVAAQVAR* |
| Ga0137412_107284472 | 3300015242 | Vadose Zone Soil | TGAIVGARNAKQAEGVMRAGELKLTAGEIAEIEGVAAAVGVR* |
| Ga0182041_100440504 | 3300016294 | Soil | VGARNAKQAEGVMRAGELKLSQEEVAELEGAAAATVR |
| Ga0182038_117582881 | 3300016445 | Soil | RNAKQAEGVMRAGELKLTADEMGEIEGAAAVATAR |
| Ga0187766_107243602 | 3300018058 | Tropical Peatland | AIVGARNAKQAEGVMSAAELRLSVEDIAEIEGTSP |
| Ga0187769_109852931 | 3300018086 | Tropical Peatland | SGAIVGARNAKQVEGIIRAGDLKLTPAEISEIEGAAAAAGGR |
| Ga0066662_119959882 | 3300018468 | Grasslands Soil | VGARNAKQVEGVMRGGDLKLTADSIAEIEGAAVAAVSR |
| Ga0193713_10667992 | 3300019882 | Soil | VGARDAKQVDGVMRAADLKLSAAEMKEIEGAAAAAGGR |
| Ga0179592_102355592 | 3300020199 | Vadose Zone Soil | VGARNAKQSEGVMRAGELKLSPEEIAEIEGAAAAAATR |
| Ga0210400_103861232 | 3300021170 | Soil | RNAKQAEGAMRAGELKLSPQDIAEIEGSAAAMAAR |
| Ga0210405_110666962 | 3300021171 | Soil | RNAKQAEGVMRAAELKLGAGEIAEIEGAAAAATGR |
| Ga0210408_103102704 | 3300021178 | Soil | VLRNSTVTGAIAGARNAKQAEGVMCAGEFPLAPEDIAEIEKAVAIAQAA |
| Ga0210408_111263121 | 3300021178 | Soil | AVSGAIVGARNAKQAEGVMRAGEIKLTSQDIAEIEATVAQAAR |
| Ga0210408_114684041 | 3300021178 | Soil | GAIVGARNAMQAEEVMRAGEIKLSPQDIAEIEGVATKVAR |
| Ga0210384_106690473 | 3300021432 | Soil | IVGARNAKQAEGVMRAGELKLSHEEIAEIEGAAAVATAR |
| Ga0210384_115485642 | 3300021432 | Soil | IVGARNAKQAEGVMRAGELKLSPEEIAEIEGAAAAATRR |
| Ga0210390_116314901 | 3300021474 | Soil | IVGARNAKQAEGVMRAGELKLTPQDIAEIEGTAAQAAR |
| Ga0210402_113034851 | 3300021478 | Soil | VGARNAKQSEGVMRAGELGLTPQDIAEIEGAAAAHAVR |
| Ga0210410_107845591 | 3300021479 | Soil | ITGVIVGARNAKQVEGVVGAADVTLTKQDIAEIEGAAAIAAAR |
| Ga0207704_111669512 | 3300025938 | Miscanthus Rhizosphere | RNAKQADGVMRAGELKLSQDEIAEIEGAAAAATAH |
| Ga0257155_10702122 | 3300026481 | Soil | RNAKQAEGVMRAGELKLTTEEIMEIEGAAAVAVAR |
| Ga0179587_103828721 | 3300026557 | Vadose Zone Soil | RNAKQAEGVMRAGELKLTAGEIAEIEGVAAAVGVR |
| Ga0209419_10361163 | 3300027537 | Forest Soil | GARNAKQAEGVMRAGELKLTPQDIAEIEGGVAQAAR |
| Ga0209076_11350782 | 3300027643 | Vadose Zone Soil | ARNAKQAEGVMRAGELKLTAGEIAEIEGVAAAVGVR |
| Ga0209448_101857382 | 3300027783 | Bog Forest Soil | VGARNAKQAEGVMRAGELKLSPEEITEIEGAAAAAVAR |
| Ga0209180_107200842 | 3300027846 | Vadose Zone Soil | VGARNAQQAEGVMRAGEIKLTPQDITEIEGVAAQVAR |
| Ga0209693_102091661 | 3300027855 | Soil | GARNAKQAEGVMRAGELKLTPEEIMEIEGAAAVAAAR |
| Ga0209167_107856252 | 3300027867 | Surface Soil | AIVGSRSAKQAEGVMKAGELKLTDQDIAQIEGKAAAIAVR |
| Ga0209283_104285773 | 3300027875 | Vadose Zone Soil | GAIVGARNAKQSEGVMRAGELKLTAEEIAEIEGAAAAATAR |
| Ga0209283_105727631 | 3300027875 | Vadose Zone Soil | GAIVGARNAKQAEGVMRAAELKLTPQDFAEIEATAAHVAR |
| Ga0209488_102337251 | 3300027903 | Vadose Zone Soil | VGARNAKQAEGVMRAAELKLTPQDFAEIEATAAHVAR |
| Ga0137415_106692142 | 3300028536 | Vadose Zone Soil | RNAKQAEGVMRAGDLKLSEEEIAEIEGAAALATAR |
| Ga0222749_104271551 | 3300029636 | Soil | GARNAKQAEGVMRAGELKLSPEEIAEIEGAAAVAVAR |
| Ga0222749_107184072 | 3300029636 | Soil | AVTGAIVGARNAKQSEGVMRAGELGLTPQDIAEIEGAAAAHAVR |
| Ga0170834_1139164742 | 3300031057 | Forest Soil | RNAKQAEGVMRAGELKLSGEEVMEIENAAATATAR |
| Ga0307476_109242791 | 3300031715 | Hardwood Forest Soil | GARNAKQAEGVMRAGELKLTGEEITEIEGAAAVAVAR |
| Ga0318500_105596991 | 3300031724 | Soil | ARNAKQVEGVMRAAELKLSAEEIAEIEGAAVIAASR |
| Ga0310917_102117573 | 3300031833 | Soil | IVGARNAKQVVGVMGAGELKLAAVEIAEIEGAAVIAASR |
| Ga0318562_103232031 | 3300032008 | Soil | TGAIVGARDAKQAEGVMRAGGLKLSAEEIVEIEGAAAAAVAR |
| Ga0318563_104790292 | 3300032009 | Soil | SPAGLARDAKQAEGVMRAGGLKLSAEEIVEIEGAAAAAVAR |
| Ga0307471_1005301573 | 3300032180 | Hardwood Forest Soil | IVGARNAKQAEGVMRAGEITLTSQDIAEIEGVAAQVAR |
| Ga0307472_1005843812 | 3300032205 | Hardwood Forest Soil | IVGARNAKQAEGVMRAGELKLSQEEITEIEGAAAAATAR |
| Ga0307472_1019175082 | 3300032205 | Hardwood Forest Soil | LNPAVSGAIVGSRNAKQAQEMMCAGELKLTPDDIKEIESAVATAQA |
| Ga0307472_1019922932 | 3300032205 | Hardwood Forest Soil | AIVGARNSKQAEEVMRAGEIKLTPQDIGEIEGTAAAQVAR |
| Ga0335085_119662321 | 3300032770 | Soil | IVGSRSAKQAEGVMRAGELKLTDQDIAQIEGKAAAMAVR |
| Ga0335080_108636531 | 3300032828 | Soil | AIVGARNAKQAEGVMRAGELKLSADEIREIEDAAAVATAR |
| Ga0316212_10325752 | 3300033547 | Roots | IVGARNAKQAEGVMRAGELKLSSEEIAEIEGAAAAAVAR |
| ⦗Top⦘ |