


| Basic Information | |
|---|---|
| Family ID | F097963 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MVLSFVATNIQLGLLLHAGVVMTALKLSAALSTCDRAMKAACSA |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.35 % |
| % of genes near scaffold ends (potentially truncated) | 84.62 % |
| % of genes from short scaffolds (< 2000 bps) | 76.92 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.192 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.731 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.346 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 58.33% β-sheet: 0.00% Coil/Unstructured: 41.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF02525 | Flavodoxin_2 | 5.77 |
| PF07366 | SnoaL | 4.81 |
| PF00578 | AhpC-TSA | 3.85 |
| PF00106 | adh_short | 2.88 |
| PF03625 | DUF302 | 1.92 |
| PF00873 | ACR_tran | 1.92 |
| PF13426 | PAS_9 | 1.92 |
| PF03284 | PHZA_PHZB | 1.92 |
| PF01522 | Polysacc_deac_1 | 1.92 |
| PF08837 | DUF1810 | 1.92 |
| PF00486 | Trans_reg_C | 1.92 |
| PF02954 | HTH_8 | 1.92 |
| PF01553 | Acyltransferase | 1.92 |
| PF02518 | HATPase_c | 1.92 |
| PF08447 | PAS_3 | 1.92 |
| PF00072 | Response_reg | 0.96 |
| PF09678 | Caa3_CtaG | 0.96 |
| PF13561 | adh_short_C2 | 0.96 |
| PF03479 | PCC | 0.96 |
| PF05368 | NmrA | 0.96 |
| PF10415 | FumaraseC_C | 0.96 |
| PF03551 | PadR | 0.96 |
| PF08281 | Sigma70_r4_2 | 0.96 |
| PF12695 | Abhydrolase_5 | 0.96 |
| PF01042 | Ribonuc_L-PSP | 0.96 |
| PF00903 | Glyoxalase | 0.96 |
| PF01243 | Putative_PNPOx | 0.96 |
| PF07992 | Pyr_redox_2 | 0.96 |
| PF08818 | DUF1801 | 0.96 |
| PF09407 | AbiEi_1 | 0.96 |
| PF05167 | DUF711 | 0.96 |
| PF02656 | DUF202 | 0.96 |
| PF13416 | SBP_bac_8 | 0.96 |
| PF01053 | Cys_Met_Meta_PP | 0.96 |
| PF00210 | Ferritin | 0.96 |
| PF02687 | FtsX | 0.96 |
| PF12697 | Abhydrolase_6 | 0.96 |
| PF00009 | GTP_EFTU | 0.96 |
| PF00723 | Glyco_hydro_15 | 0.96 |
| PF10518 | TAT_signal | 0.96 |
| PF07732 | Cu-oxidase_3 | 0.96 |
| PF04295 | GD_AH_C | 0.96 |
| PF00561 | Abhydrolase_1 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 1.92 |
| COG5579 | Uncharacterized conserved protein, DUF1810 family | Function unknown [S] | 1.92 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.96 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.96 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.96 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.96 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.96 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.96 |
| COG1661 | Predicted DNA-binding protein with PD1-like DNA-binding motif, PPC/DUF296 domain | General function prediction only [R] | 0.96 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.96 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.96 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.96 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.96 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.96 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.96 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.96 |
| COG2721 | Altronate dehydratase | Carbohydrate transport and metabolism [G] | 0.96 |
| COG2848 | Uncharacterized conserved protein, UPF0210 family | Cell cycle control, cell division, chromosome partitioning [D] | 0.96 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.96 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.96 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.96 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.96 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.19 % |
| Unclassified | root | N/A | 4.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100154315 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300001083|JGI12678J13193_1001727 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300001159|JGI12650J13346_1008624 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300001174|JGI12679J13547_1001339 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300001593|JGI12635J15846_10029014 | All Organisms → cellular organisms → Bacteria | 4445 | Open in IMG/M |
| 3300001593|JGI12635J15846_10377087 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300004092|Ga0062389_102594582 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 674 | Open in IMG/M |
| 3300004092|Ga0062389_102737799 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300004092|Ga0062389_103403108 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005167|Ga0066672_10050592 | All Organisms → cellular organisms → Bacteria | 2379 | Open in IMG/M |
| 3300005176|Ga0066679_10482790 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300005176|Ga0066679_11003895 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005177|Ga0066690_10002606 | All Organisms → cellular organisms → Bacteria | 7479 | Open in IMG/M |
| 3300005181|Ga0066678_10449223 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300005294|Ga0065705_10169777 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300005450|Ga0066682_10907985 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 524 | Open in IMG/M |
| 3300005544|Ga0070686_100768162 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300005554|Ga0066661_10957343 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005555|Ga0066692_10178289 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1319 | Open in IMG/M |
| 3300005557|Ga0066704_10030020 | All Organisms → cellular organisms → Bacteria | 3306 | Open in IMG/M |
| 3300005568|Ga0066703_10319097 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300005569|Ga0066705_10038426 | All Organisms → cellular organisms → Bacteria | 2626 | Open in IMG/M |
| 3300005598|Ga0066706_10930978 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300005712|Ga0070764_10265974 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 980 | Open in IMG/M |
| 3300005764|Ga0066903_100192548 | All Organisms → cellular organisms → Bacteria | 3032 | Open in IMG/M |
| 3300005921|Ga0070766_11043172 | Not Available | 563 | Open in IMG/M |
| 3300005993|Ga0080027_10123424 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 982 | Open in IMG/M |
| 3300006172|Ga0075018_10649295 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300006173|Ga0070716_100498625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
| 3300006791|Ga0066653_10012687 | All Organisms → cellular organisms → Bacteria | 2975 | Open in IMG/M |
| 3300006797|Ga0066659_10132525 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1746 | Open in IMG/M |
| 3300006797|Ga0066659_10171223 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300006797|Ga0066659_11145399 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 650 | Open in IMG/M |
| 3300006797|Ga0066659_11236190 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300006800|Ga0066660_11440373 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006800|Ga0066660_11625583 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300007258|Ga0099793_10125634 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300009089|Ga0099828_10248170 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300009137|Ga0066709_101746313 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300009610|Ga0105340_1261359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300012199|Ga0137383_10004102 | All Organisms → cellular organisms → Bacteria | 9228 | Open in IMG/M |
| 3300012207|Ga0137381_10000209 | All Organisms → cellular organisms → Bacteria | 35875 | Open in IMG/M |
| 3300012357|Ga0137384_10000308 | All Organisms → cellular organisms → Bacteria | 36078 | Open in IMG/M |
| 3300012685|Ga0137397_10489546 | Not Available | 916 | Open in IMG/M |
| 3300015053|Ga0137405_1335615 | All Organisms → cellular organisms → Bacteria | 4370 | Open in IMG/M |
| 3300017659|Ga0134083_10295704 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300017998|Ga0187870_1187499 | Not Available | 734 | Open in IMG/M |
| 3300018027|Ga0184605_10349668 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 667 | Open in IMG/M |
| 3300018051|Ga0184620_10093900 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 916 | Open in IMG/M |
| 3300018066|Ga0184617_1181899 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300018433|Ga0066667_10525727 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 978 | Open in IMG/M |
| 3300018482|Ga0066669_11113638 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300019879|Ga0193723_1047755 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 1262 | Open in IMG/M |
| 3300019879|Ga0193723_1073199 | Not Available | 987 | Open in IMG/M |
| 3300019890|Ga0193728_1072356 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1636 | Open in IMG/M |
| 3300019890|Ga0193728_1130495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. dw_53 | 1128 | Open in IMG/M |
| 3300020004|Ga0193755_1106057 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 886 | Open in IMG/M |
| 3300020170|Ga0179594_10248130 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300020199|Ga0179592_10401160 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300020579|Ga0210407_10162702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1724 | Open in IMG/M |
| 3300020579|Ga0210407_10626363 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 837 | Open in IMG/M |
| 3300021168|Ga0210406_10067313 | All Organisms → cellular organisms → Bacteria | 3088 | Open in IMG/M |
| 3300021168|Ga0210406_11119635 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300021344|Ga0193719_10024854 | All Organisms → cellular organisms → Bacteria | 2568 | Open in IMG/M |
| 3300021479|Ga0210410_10102891 | All Organisms → cellular organisms → Bacteria | 2522 | Open in IMG/M |
| 3300021479|Ga0210410_11700390 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300023250|Ga0224544_1000864 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae | 4193 | Open in IMG/M |
| 3300024227|Ga0228598_1043455 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 888 | Open in IMG/M |
| 3300025453|Ga0208455_1076658 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300025460|Ga0208562_1075224 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 689 | Open in IMG/M |
| 3300025915|Ga0207693_10156625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1792 | Open in IMG/M |
| 3300025922|Ga0207646_10886390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
| 3300026023|Ga0207677_10215390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1537 | Open in IMG/M |
| 3300026300|Ga0209027_1071013 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300026300|Ga0209027_1234955 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300026331|Ga0209267_1002461 | All Organisms → cellular organisms → Bacteria | 11929 | Open in IMG/M |
| 3300026332|Ga0209803_1004323 | All Organisms → cellular organisms → Bacteria | 8328 | Open in IMG/M |
| 3300026538|Ga0209056_10060916 | All Organisms → cellular organisms → Bacteria | 3302 | Open in IMG/M |
| 3300026547|Ga0209156_10029627 | All Organisms → cellular organisms → Bacteria | 3125 | Open in IMG/M |
| 3300026548|Ga0209161_10105608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1690 | Open in IMG/M |
| 3300026551|Ga0209648_10483110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 735 | Open in IMG/M |
| 3300026552|Ga0209577_10596246 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300026702|Ga0208708_101625 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300027439|Ga0209332_1001729 | All Organisms → cellular organisms → Bacteria | 4746 | Open in IMG/M |
| 3300027537|Ga0209419_1037559 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300027559|Ga0209222_1044987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 851 | Open in IMG/M |
| 3300027575|Ga0209525_1076813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
| 3300027591|Ga0209733_1089796 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300027648|Ga0209420_1121551 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300027678|Ga0209011_1137157 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300027748|Ga0209689_1022186 | All Organisms → cellular organisms → Bacteria | 3911 | Open in IMG/M |
| 3300028047|Ga0209526_10023794 | All Organisms → cellular organisms → Bacteria | 4290 | Open in IMG/M |
| 3300028047|Ga0209526_10556716 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300028784|Ga0307282_10373144 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 690 | Open in IMG/M |
| 3300028882|Ga0302154_10306763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
| 3300029951|Ga0311371_10261338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2486 | Open in IMG/M |
| 3300030057|Ga0302176_10334889 | Not Available | 609 | Open in IMG/M |
| 3300030617|Ga0311356_10789531 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 902 | Open in IMG/M |
| 3300030998|Ga0073996_12393598 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300031028|Ga0302180_10083945 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
| 3300031469|Ga0170819_11049608 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300031912|Ga0306921_11542374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300032001|Ga0306922_11158573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium capsulatum | 789 | Open in IMG/M |
| 3300032180|Ga0307471_100187922 | All Organisms → cellular organisms → Bacteria | 2048 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 25.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 13.46% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.77% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.88% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.96% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.96% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001083 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 | Environmental | Open in IMG/M |
| 3300001159 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026702 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN593 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030998 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1001543151 | 3300000559 | Soil | MVLSAAATNIQLGLLLHAAVVMTALKLSAKFNTCERAMKAACSADRSAAKYS |
| JGI12678J13193_10017271 | 3300001083 | Forest Soil | MVLSAPATSAQLGLLLHAAVVMTALKLSAKFSTCDRAMKAACS |
| JGI12650J13346_10086242 | 3300001159 | Forest Soil | MVLSFVATNIQLGLLFHAAVVMTALKLSAKLSTCDRAMKAA |
| JGI12679J13547_10013393 | 3300001174 | Forest Soil | MVLSAPATSAQLGLLLHAAVVMTALKLSAKFSTCDRAMKAACSADR |
| JGI12635J15846_100290142 | 3300001593 | Forest Soil | MALSFAATNIQLGLLLHAGLVMAALKLSTKLSTCDRAMKPACSADRSAAKYS* |
| JGI12635J15846_103770871 | 3300001593 | Forest Soil | MVLSAPATSAQLGLLLHAAVVMTALKLSAKFSTCDR |
| Ga0062389_1025945821 | 3300004092 | Bog Forest Soil | MVLSLPATNIQLGLLLHAGTVMTALKFSALFNTCDHAMKAA |
| Ga0062389_1027377991 | 3300004092 | Bog Forest Soil | MVRSLPATNIQLGLLLHAAVVMTALKLSPKLKTCERAMKA |
| Ga0062389_1034031081 | 3300004092 | Bog Forest Soil | LIVLSFPATSIQLGLPLQAGVVMTAWKLESLIHTCERAMKAACS |
| Ga0066672_100505925 | 3300005167 | Soil | MVLSFVATSIQLGLLLHAAVVMTALKLSARLSTCDRAMKAACSAERSA |
| Ga0066679_104827902 | 3300005176 | Soil | MALSFAGTSIQLGLLLHAAVLITALKFSATLSTCDRAMKAA |
| Ga0066679_110038951 | 3300005176 | Soil | MVLSFAATNIQLGLLLHAGVVMTALKLSAALSTCDRAMKAAC |
| Ga0066690_100026065 | 3300005177 | Soil | MVLSLSANIQLGLLLHAGVVMTALKLSAKLDTCDRAMKAACSADKSAAKYS* |
| Ga0066678_104492232 | 3300005181 | Soil | MVLSFVATNIQLGLFLQAGVVMIALKFSAAFSTCDRAIRAACS |
| Ga0065705_101697772 | 3300005294 | Switchgrass Rhizosphere | MVLSFPATNIQLGLLLHAAVVITALKFSAALNTCDRAMKAACSADRSAAKYS* |
| Ga0066682_109079852 | 3300005450 | Soil | GLMVLSLSANIQLGLLLHAGVVMTALKLSAKLDTCDRAMKAACSADKSAAKYS* |
| Ga0070686_1007681622 | 3300005544 | Switchgrass Rhizosphere | MVRSAAATYIQLGLLLHAAVVMTALKLSAKFNLCERAIKAACSADRSA |
| Ga0066661_109573431 | 3300005554 | Soil | MVLSFVATNIQLGLLLHAGVVMTALKLSAKLSTCDRAMKA |
| Ga0066692_101782891 | 3300005555 | Soil | MVLSFVATNIQLGLLLHAGVVMTALKLSAALSTCDRAMKAACSA |
| Ga0066704_100300202 | 3300005557 | Soil | MVLSFVATNIQLGLLLHAAVVMTALKLSAKLSTCDRAMKAACSADRSAAKY |
| Ga0066703_103190972 | 3300005568 | Soil | MVLSFAATNIQLGLLRHAGVVMTALKLSAKLSTCDRAMKAACS |
| Ga0066705_100384265 | 3300005569 | Soil | MVLSFVATNIQLGLLLHAAVVMTALKLSAKLSTCDRAMK |
| Ga0066706_109309782 | 3300005598 | Soil | TNIQLGLLLHAGVVMTALKLSAKLSTCDRAMKAASTLYALHVL* |
| Ga0070764_102659742 | 3300005712 | Soil | MVLSLPATNIQLGLLLHAGVLMTALKLSAALSTCDRAMKA |
| Ga0066903_1001925482 | 3300005764 | Tropical Forest Soil | MVLSFVATNIQLGVLLHAAVVMTALKLSAKLSTCDRAMKAACSAERSAAKYS* |
| Ga0070766_110431721 | 3300005921 | Soil | MVLSAPAINIQLGLIRHEAVVMTALKLSAALSTCVRAMKAACSADKS |
| Ga0080027_101234242 | 3300005993 | Prmafrost Soil | MVLSFAATNIQLGLLLHAGVVMTALKLSAALSTCDRAMKAA |
| Ga0075018_106492952 | 3300006172 | Watersheds | MVLSFVATNIQLGLVLHAAVVMTALKLSAALSTCDRAMKAAC |
| Ga0070716_1004986252 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ATNIQLGLLLHAGVVMTALKLSAALSTCDRAMKAACSADRSAAKYS* |
| Ga0066653_100126873 | 3300006791 | Soil | MVLSFTATNIQLGLLLHAGVVITALKLSAALSTCDRATKAACSADKSAAKYS* |
| Ga0066659_101325251 | 3300006797 | Soil | MVLSFVATNIQLGLLLHAAVVMTALKLSAKFSTADRAMKASCSA |
| Ga0066659_101712232 | 3300006797 | Soil | MVLSFAATNIQLGLLLHAAALMTALKLSAALSTCDRAMEAACSADRSFAKYA* |
| Ga0066659_111453992 | 3300006797 | Soil | MVLSFVATNIQLGLLLHAAVVMTALKLSAALSTCD |
| Ga0066659_112361902 | 3300006797 | Soil | MVLSVAATSIQLGLFLHAAVVMTALKFSAALSTCDRAMNVACSADRSAA |
| Ga0066660_114403732 | 3300006800 | Soil | MVLSFTATNIQLGLLLHAGVVITALKLSAALSTCDRA |
| Ga0066660_116255832 | 3300006800 | Soil | MALSFVATNIQLGLVLHAGAVMAALKLSAKLSTCDRAMKEACSADR |
| Ga0099793_101256343 | 3300007258 | Vadose Zone Soil | ATNIQLGLLLHAAVVMTALKLSAALNTCERDMNAACSADRLAAKYS* |
| Ga0099828_102481701 | 3300009089 | Vadose Zone Soil | MVLSAPATSIQLGLLLHAAAVMTALKLSAKLGTCDRAMKA |
| Ga0066709_1017463131 | 3300009137 | Grasslands Soil | MVLSAAATNIQLGLLLHAGVVMTALKLSAALSTCDRAMKAA |
| Ga0105340_12613592 | 3300009610 | Soil | MILSFVATAIQLGFVLHAAFAITAVKLSAKFRTCDLAMKEACSNDKSAAKYSWNCAGSR* |
| Ga0137383_100041027 | 3300012199 | Vadose Zone Soil | MVLSFPATNIQLGLLLHAGVVMTALKLSAKLSTCDHAMKAACSAERSAAKYS* |
| Ga0137381_100002092 | 3300012207 | Vadose Zone Soil | MVLSFPATNIQLGLLLHAGVVMTALKLSAKLSTCDHAMKTACSAERSAAKYS* |
| Ga0137384_1000030843 | 3300012357 | Vadose Zone Soil | NIQLGLLLHAGVVMTALKLSAKLSTCDHAMKAACSAERSAAKYS* |
| Ga0137397_104895462 | 3300012685 | Vadose Zone Soil | MVLSFAATNIQLDLLLHAGVVMTALKLVAAMSTCELAMKAACSA* |
| Ga0137405_13356155 | 3300015053 | Vadose Zone Soil | MVLSFVATNIQLGLLLHAGVVITALKFSAALSTCDRAMKAACSAGRSAAKYS* |
| Ga0134083_102957041 | 3300017659 | Grasslands Soil | MVLSFVATNIQLGLHLHAGVVMTALKLSAALSTCDRAMKAACSADRSA |
| Ga0187870_11874991 | 3300017998 | Peatland | MVLSFVATNIQLGLLLQAGVVMTALKLATAFSTCDRAMKAACTEGRKTR |
| Ga0184605_103496682 | 3300018027 | Groundwater Sediment | MVLSFVGTNIQLGLLLHAGVVMTALKLSAALSTCDRAMKAACSADRSAAK |
| Ga0184620_100939001 | 3300018051 | Groundwater Sediment | MVLSFVATNIQLGLLLHAGVVMTALKLSAALSTCDRAMNAACSADKS |
| Ga0184617_11818992 | 3300018066 | Groundwater Sediment | MVLSFVATNIQLGLLRHAGVVMTALKLSAALRTCDRAMKA |
| Ga0066667_105257271 | 3300018433 | Grasslands Soil | MVLSFVATNIQLGLLLHAGVVMTALKLSAALSTCDRAM |
| Ga0066669_111136381 | 3300018482 | Grasslands Soil | MVLSFVATNIQLGLVRHAGVVMTALKLSTKLSTFDRAMNPALSADRSATK |
| Ga0193723_10477552 | 3300019879 | Soil | MVRSFVATNIQLGLLLHAAVVMTALKLSAKFNTCDRAM |
| Ga0193723_10731993 | 3300019879 | Soil | MVLSFVATNIQLGLLLHAGVVMTPLKFAARIGTCECAAKAACLTGMSAA |
| Ga0193728_10723561 | 3300019890 | Soil | MVLSFAATNTQLGLLLHAGVVMTALKLSAALSTCDRA |
| Ga0193728_11304951 | 3300019890 | Soil | MVLSFAATNTQLGLLRHADMVMTALKLSAALSTCDRAMKAACSADKS |
| Ga0193755_11060571 | 3300020004 | Soil | MVLSFVATNIQLGLLLHAGVVMTALKLSAALSTCDRA |
| Ga0179594_102481301 | 3300020170 | Vadose Zone Soil | MVLSFVATNIQLGLLLHAAVVMTALKLSARLSTWD |
| Ga0179592_104011601 | 3300020199 | Vadose Zone Soil | MVLSAPATNAQLGLVLHAAVVITALKLSAKLGTCARAMKAANFADNFK |
| Ga0210407_101627021 | 3300020579 | Soil | MVLSFAATNIQRGLLRHAGVAMIALRLSAALGTSLP |
| Ga0210407_106263631 | 3300020579 | Soil | IQLGLLLHAGVVITALKLSAALGTCDRAMKEACSADKSAAKHS |
| Ga0210406_100673135 | 3300021168 | Soil | MALSFVDTTIQLGLLLHAAAVMTALKLSAKFNTCDR |
| Ga0210406_111196351 | 3300021168 | Soil | MVLSAPATSTQVGLLLHAATVITALKLPAALKTCDRAMKAA |
| Ga0193719_100248544 | 3300021344 | Soil | MVLSFVATNIQLGLLLHAGVVMTALKLSAKLNTCDRAMK |
| Ga0210410_101028913 | 3300021479 | Soil | MVLSFAATNIQLGLLLHAGVVMTALKLSAALGTCDRAMKAACSTDRSAAK |
| Ga0210410_117003902 | 3300021479 | Soil | MVLSAPATNIQLGLLLHAAVVMTALKLSAKLSTCERAMKAACSTDIVGRLR |
| Ga0224544_10008646 | 3300023250 | Soil | MVLSLPATNIQLGLLLHAAVVMTALKLSAKLSTCDRAIKAAC |
| Ga0228598_10434553 | 3300024227 | Rhizosphere | QLGLLLHAAVVMTALKLSAKLSTCDRAMKAACSADKSAAKYS |
| Ga0208455_10766581 | 3300025453 | Peatland | MVLSFVATNIQLGLLLQAGVVMTALKLATAFSTCDRAMKAACTEG |
| Ga0208562_10752243 | 3300025460 | Peatland | MVLSLPATNIQLGLLLHAGVVMTPLKFSALFITCD |
| Ga0207693_101566251 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLSFVATNIQLGLLLHAAVVMTALKLSARLSTCDRA |
| Ga0207646_108863901 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLSFAATNIQLGLLLHAGVVITALKLSAALSTCDRAMKAACSTGKSAAQY |
| Ga0207677_102153901 | 3300026023 | Miscanthus Rhizosphere | MVLSFAATNIQLGLLRHAAVVMAALKLSAPLSTCD |
| Ga0209027_10710131 | 3300026300 | Grasslands Soil | MVLSFVATSIQLGLLLHAAVVMTALKLSARLSTCDRAMKAA |
| Ga0209027_12349552 | 3300026300 | Grasslands Soil | MVLSFVATNIQLGLLLHAAVVITALKLSAKLSTCDRAMN |
| Ga0209267_10024615 | 3300026331 | Soil | MVLSLSANIQLGLLLHAGVVMTALKLSAKLDTCDRAMKAACSADKSAAKYS |
| Ga0209803_100432311 | 3300026332 | Soil | MVLSLSANIQLGLLLHAGVVMTALKLSAKLDTCDRAMKAACSADKS |
| Ga0209056_100609163 | 3300026538 | Soil | MVLSFTATNIQLGLLLHAGVVITALKLSAALSTCDRAMKAACSADKSAAKYS |
| Ga0209156_100296273 | 3300026547 | Soil | MVLSFAATNIQLGLLLHAGVVMTALKLSAALSTCDRAMKAACSADKSAAKYS |
| Ga0209161_101056083 | 3300026548 | Soil | MVLSFAATNIQLGLLLHAAALMTALKLSAALSTCDRAMEAACSAD |
| Ga0209648_104831102 | 3300026551 | Grasslands Soil | MVLSFVATNIQLGLLLHAAVVMTALKLSAALSTCDR |
| Ga0209577_105962461 | 3300026552 | Soil | MVLSAPATSIQLGLPLHAGVVMTALKLSVKLSTCDRAMKAACSADRS |
| Ga0208708_1016251 | 3300026702 | Soil | GLIVLSFVATNIQLVLVLHAAVVMTALKLSARLSTCDRAMKAACAAGRSAAKYS |
| Ga0209332_10017293 | 3300027439 | Forest Soil | MVLSLPATNIQLDLVLHAGVVIAALKLSALFSTCDRAMKAACSADRSAAKYS |
| Ga0209419_10375592 | 3300027537 | Forest Soil | MVLSAPATSAQLGLLLHAAVVMTALKLSAKFSACDRAMKAACSA |
| Ga0209222_10449871 | 3300027559 | Forest Soil | MVLSFAATTIQLGLLRHAGAVMVALKFTAALSTCDRAMK |
| Ga0209525_10768132 | 3300027575 | Forest Soil | VLSDPATNIQLGLLFHAAVVITALKLPAKLNTCERAIKAARSADRSATKYS |
| Ga0209733_10897961 | 3300027591 | Forest Soil | MALSFAATNIQLGLVLHAAVEMVALKLSARLSTCDRAIKAACS |
| Ga0209420_11215511 | 3300027648 | Forest Soil | MVLSLPATNIQLGLLLHAAVVMTALKLSALFSTWDRAMKAA |
| Ga0209011_11371571 | 3300027678 | Forest Soil | MVLSAPATNAQLGLVLHAAVVITALKLSAKLGTCDRAMKA |
| Ga0209689_10221861 | 3300027748 | Soil | MVLSFVATNIQLGLLLHAGAVMTALKLSARLSTCDRAMKAA |
| Ga0209526_100237941 | 3300028047 | Forest Soil | MVLSFAATNTQLGLLRHAAVVMTALKLSARLSTCERAMKAACSADRS |
| Ga0209526_105567161 | 3300028047 | Forest Soil | MVLSAAATNIQLGLPRHAAVVMTALKLSAKLGTCDRAIKAAC |
| Ga0307282_103731442 | 3300028784 | Soil | MVLSFAATNIQLGLLLHAAVVMTALKLSAALSTCDRAVK |
| Ga0302154_103067631 | 3300028882 | Bog | MALSLPAISAQLGLLLHAAVVMTALKLLAAFITCDRAMKAAWSA |
| Ga0311371_102613381 | 3300029951 | Palsa | VVLSLAATNSQLGLLLHAGVMITALKLSAPVSTCDRA |
| Ga0302176_103348891 | 3300030057 | Palsa | VVLSLAATNSQLGLLLHAGVMITALKLSAPVSTCDPAMKAAALKIGR |
| Ga0311356_107895311 | 3300030617 | Palsa | MVLSLPATNIQLGLLLHAAVVMTALKLSAKLSTCDRAMNAACSAGR |
| Ga0073996_123935981 | 3300030998 | Soil | MVLSFVATNIQLGLFLHAGVVMTALKLSAKLSTCDRAMKAACSADRSAAK |
| Ga0302180_100839452 | 3300031028 | Palsa | MVLSFPATSIQLGLLLHAGAVMTALKLSEAFSTCDRAIKAACS |
| Ga0170819_110496082 | 3300031469 | Forest Soil | MVLSFVATNIQLGLLLHAGVVMTALKLSAKLNTCDRA |
| Ga0306921_115423742 | 3300031912 | Soil | MVLSLAATNIQLGLLLHAGLVMTALKLAAALSTCDRAMKAACS |
| Ga0306922_111585731 | 3300032001 | Soil | MVLSFVATNIQLGLLLHAGLVMTALKLAAALSTCDRAMKAACSAGRS |
| Ga0307471_1001879223 | 3300032180 | Hardwood Forest Soil | MVLSAPATNIQLGLLLHAAAVMTALKLSAKLSTCDRAIKAACSADR |
| ⦗Top⦘ |