


| Basic Information | |
|---|---|
| Family ID | F097959 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 39 residues |
| Representative Sequence | PDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 85.58 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.308 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.423 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.115 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (33.654 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF13565 | HTH_32 | 3.85 |
| PF13358 | DDE_3 | 2.88 |
| PF01710 | HTH_Tnp_IS630 | 1.92 |
| PF05598 | DUF772 | 1.92 |
| PF13751 | DDE_Tnp_1_6 | 1.92 |
| PF00480 | ROK | 1.92 |
| PF03401 | TctC | 0.96 |
| PF03976 | PPK2 | 0.96 |
| PF00912 | Transgly | 0.96 |
| PF00501 | AMP-binding | 0.96 |
| PF14294 | DUF4372 | 0.96 |
| PF00149 | Metallophos | 0.96 |
| PF00581 | Rhodanese | 0.96 |
| PF05222 | AlaDh_PNT_N | 0.96 |
| PF06411 | HdeA | 0.96 |
| PF00899 | ThiF | 0.96 |
| PF06707 | DUF1194 | 0.96 |
| PF01522 | Polysacc_deac_1 | 0.96 |
| PF13586 | DDE_Tnp_1_2 | 0.96 |
| PF13532 | 2OG-FeII_Oxy_2 | 0.96 |
| PF07045 | DUF1330 | 0.96 |
| PF09722 | Xre_MbcA_ParS_C | 0.96 |
| PF14305 | ATPgrasp_TupA | 0.96 |
| PF03435 | Sacchrp_dh_NADP | 0.96 |
| PF04800 | NDUS4 | 0.96 |
| PF00005 | ABC_tran | 0.96 |
| PF06035 | Peptidase_C93 | 0.96 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.96 |
| PF01926 | MMR_HSR1 | 0.96 |
| PF13005 | zf-IS66 | 0.96 |
| PF14497 | GST_C_3 | 0.96 |
| PF04964 | Flp_Fap | 0.96 |
| PF01970 | TctA | 0.96 |
| PF11974 | bMG3 | 0.96 |
| PF03631 | Virul_fac_BrkB | 0.96 |
| PF13384 | HTH_23 | 0.96 |
| PF09650 | PHA_gran_rgn | 0.96 |
| PF12849 | PBP_like_2 | 0.96 |
| PF07819 | PGAP1 | 0.96 |
| PF00374 | NiFeSe_Hases | 0.96 |
| PF00348 | polyprenyl_synt | 0.96 |
| PF01726 | LexA_DNA_bind | 0.96 |
| PF03929 | PepSY_TM | 0.96 |
| PF02861 | Clp_N | 0.96 |
| PF14224 | DUF4331 | 0.96 |
| PF13492 | GAF_3 | 0.96 |
| PF03466 | LysR_substrate | 0.96 |
| PF11014 | DUF2852 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 3.85 |
| COG3415 | CRISPR-associated protein Csa3, CARF domain | Defense mechanisms [V] | 1.92 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.96 |
| COG0374 | Ni,Fe-hydrogenase I large subunit | Energy production and conversion [C] | 0.96 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.96 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG1075 | Triacylglycerol esterase/lipase EstA, alpha/beta hydrolase fold | Lipid transport and metabolism [I] | 0.96 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.96 |
| COG1784 | TctA family transporter | General function prediction only [R] | 0.96 |
| COG2267 | Lysophospholipase, alpha-beta hydrolase superfamily | Lipid transport and metabolism [I] | 0.96 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.96 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.96 |
| COG3182 | PepSY-associated TM region | Function unknown [S] | 0.96 |
| COG3259 | Coenzyme F420-reducing hydrogenase, alpha subunit | Energy production and conversion [C] | 0.96 |
| COG3295 | Uncharacterized conserved protein | Function unknown [S] | 0.96 |
| COG3333 | TctA family transporter | General function prediction only [R] | 0.96 |
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.96 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.31 % |
| Unclassified | root | N/A | 32.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459002|FZY7DQ102GXV9T | Not Available | 537 | Open in IMG/M |
| 3300001081|JGI12662J13196_1022085 | Not Available | 528 | Open in IMG/M |
| 3300001545|JGI12630J15595_10044127 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300005277|Ga0065716_1016576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 546 | Open in IMG/M |
| 3300005445|Ga0070708_100983205 | Not Available | 791 | Open in IMG/M |
| 3300005598|Ga0066706_11205976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 575 | Open in IMG/M |
| 3300005764|Ga0066903_105317334 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300006041|Ga0075023_100557735 | Not Available | 525 | Open in IMG/M |
| 3300006046|Ga0066652_100232760 | Not Available | 1604 | Open in IMG/M |
| 3300006047|Ga0075024_100758622 | Not Available | 539 | Open in IMG/M |
| 3300006052|Ga0075029_100710901 | Not Available | 678 | Open in IMG/M |
| 3300006055|Ga0097691_1064693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1193 | Open in IMG/M |
| 3300006057|Ga0075026_100515563 | Not Available | 690 | Open in IMG/M |
| 3300006059|Ga0075017_100255271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1283 | Open in IMG/M |
| 3300006086|Ga0075019_11012678 | Not Available | 536 | Open in IMG/M |
| 3300006172|Ga0075018_10727675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Pleomorphomonas → environmental samples → uncultured Pleomorphomonas sp. | 539 | Open in IMG/M |
| 3300006175|Ga0070712_101985495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 509 | Open in IMG/M |
| 3300006176|Ga0070765_101722484 | Not Available | 588 | Open in IMG/M |
| 3300006176|Ga0070765_101792872 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300006797|Ga0066659_10883815 | Not Available | 745 | Open in IMG/M |
| 3300007788|Ga0099795_10120794 | Not Available | 1047 | Open in IMG/M |
| 3300009038|Ga0099829_10564236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 946 | Open in IMG/M |
| 3300009176|Ga0105242_11012872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 839 | Open in IMG/M |
| 3300010147|Ga0126319_1055221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300010398|Ga0126383_12941060 | Not Available | 556 | Open in IMG/M |
| 3300011270|Ga0137391_10088632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2674 | Open in IMG/M |
| 3300011270|Ga0137391_10163734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1938 | Open in IMG/M |
| 3300012201|Ga0137365_11247949 | Not Available | 529 | Open in IMG/M |
| 3300012205|Ga0137362_11417308 | Not Available | 581 | Open in IMG/M |
| 3300012349|Ga0137387_10641585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 769 | Open in IMG/M |
| 3300012356|Ga0137371_11404798 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012527|Ga0136633_1157997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. WL6 | 871 | Open in IMG/M |
| 3300012917|Ga0137395_10181402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1458 | Open in IMG/M |
| 3300012923|Ga0137359_10187048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Aquabacter → Aquabacter spiritensis | 1850 | Open in IMG/M |
| 3300012925|Ga0137419_11154413 | Not Available | 647 | Open in IMG/M |
| 3300012944|Ga0137410_11414877 | Not Available | 605 | Open in IMG/M |
| 3300014200|Ga0181526_10818814 | Not Available | 586 | Open in IMG/M |
| 3300014492|Ga0182013_10015692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella silvestris | 7271 | Open in IMG/M |
| 3300014499|Ga0182012_10081225 | Not Available | 2489 | Open in IMG/M |
| 3300014638|Ga0181536_10372847 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300014657|Ga0181522_10907645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300014838|Ga0182030_10485535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1241 | Open in IMG/M |
| 3300014838|Ga0182030_10597908 | Not Available | 1065 | Open in IMG/M |
| 3300014969|Ga0157376_10151532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium LM-1 | 2091 | Open in IMG/M |
| 3300014969|Ga0157376_10835113 | Not Available | 936 | Open in IMG/M |
| 3300015090|Ga0167634_1001223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Aquabacter → Aquabacter spiritensis | 3178 | Open in IMG/M |
| 3300016319|Ga0182033_10141459 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300016319|Ga0182033_11310365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 651 | Open in IMG/M |
| 3300017942|Ga0187808_10512197 | Not Available | 557 | Open in IMG/M |
| 3300017972|Ga0187781_10077234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2300 | Open in IMG/M |
| 3300018064|Ga0187773_11257115 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300020012|Ga0193732_1012699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens → Bradyrhizobium diazoefficiens SEMIA 5080 | 1457 | Open in IMG/M |
| 3300020074|Ga0194113_10133878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. SC2 | 2091 | Open in IMG/M |
| 3300020083|Ga0194111_10011423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. SC2 | 9444 | Open in IMG/M |
| 3300020083|Ga0194111_10288821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis | 1135 | Open in IMG/M |
| 3300020220|Ga0194119_10010056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12548 | Open in IMG/M |
| 3300020220|Ga0194119_10439618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 835 | Open in IMG/M |
| 3300020222|Ga0194125_10635922 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300020579|Ga0210407_10618358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Rhodoblastus → Candidatus Rhodoblastus alkanivorans | 844 | Open in IMG/M |
| 3300020583|Ga0210401_10953003 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300020603|Ga0194126_10015616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis | 9217 | Open in IMG/M |
| 3300021086|Ga0179596_10683818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 519 | Open in IMG/M |
| 3300021168|Ga0210406_10981986 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300021344|Ga0193719_10077115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1447 | Open in IMG/M |
| 3300021405|Ga0210387_10365393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1276 | Open in IMG/M |
| 3300021475|Ga0210392_10667946 | Not Available | 773 | Open in IMG/M |
| 3300021478|Ga0210402_10944342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → unclassified Methylocapsa → Methylocapsa sp. S129 | 789 | Open in IMG/M |
| 3300021860|Ga0213851_1764581 | Not Available | 557 | Open in IMG/M |
| 3300025903|Ga0207680_10756542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 696 | Open in IMG/M |
| 3300025916|Ga0207663_11066864 | Not Available | 649 | Open in IMG/M |
| 3300025922|Ga0207646_11614165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300026482|Ga0257172_1030343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 975 | Open in IMG/M |
| 3300026496|Ga0257157_1064045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 626 | Open in IMG/M |
| 3300027846|Ga0209180_10186463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Stellaceae → Stella → Stella humosa | 1197 | Open in IMG/M |
| 3300027863|Ga0207433_10099156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM2254 | 2693 | Open in IMG/M |
| 3300027894|Ga0209068_10247720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 990 | Open in IMG/M |
| 3300027898|Ga0209067_10604353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300027903|Ga0209488_10073271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 2541 | Open in IMG/M |
| 3300028047|Ga0209526_10037858 | All Organisms → cellular organisms → Bacteria | 3394 | Open in IMG/M |
| 3300028138|Ga0247684_1005581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Aquabacter → Aquabacter spiritensis | 1971 | Open in IMG/M |
| 3300028819|Ga0307296_10592290 | Not Available | 607 | Open in IMG/M |
| 3300029625|Ga0311297_1088746 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300029943|Ga0311340_10059179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4462 | Open in IMG/M |
| 3300030873|Ga0265751_107915 | Not Available | 647 | Open in IMG/M |
| 3300031057|Ga0170834_100845984 | Not Available | 642 | Open in IMG/M |
| 3300031057|Ga0170834_110989557 | Not Available | 1049 | Open in IMG/M |
| 3300031170|Ga0307498_10024988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1410 | Open in IMG/M |
| 3300031231|Ga0170824_107146114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1227 | Open in IMG/M |
| 3300031524|Ga0302320_10713551 | Not Available | 1135 | Open in IMG/M |
| 3300031545|Ga0318541_10311893 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300031669|Ga0307375_10445115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 793 | Open in IMG/M |
| 3300031890|Ga0306925_11743937 | Not Available | 599 | Open in IMG/M |
| 3300031912|Ga0306921_11255545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 822 | Open in IMG/M |
| 3300031942|Ga0310916_10910860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 737 | Open in IMG/M |
| 3300031947|Ga0310909_10200510 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300032261|Ga0306920_101776557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 871 | Open in IMG/M |
| 3300032516|Ga0315273_13216473 | Not Available | 505 | Open in IMG/M |
| 3300033402|Ga0326728_10149000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2547 | Open in IMG/M |
| 3300033402|Ga0326728_10437656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae | 1095 | Open in IMG/M |
| 3300033402|Ga0326728_10710315 | Not Available | 753 | Open in IMG/M |
| 3300033405|Ga0326727_10359349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae | 1372 | Open in IMG/M |
| 3300033405|Ga0326727_10433581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae | 1183 | Open in IMG/M |
| 3300033405|Ga0326727_10514775 | Not Available | 1035 | Open in IMG/M |
| 3300033405|Ga0326727_10548130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 985 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.54% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 8.65% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.73% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.81% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.96% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.96% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.96% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 0.96% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.96% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.96% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.96% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.96% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 3300001081 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012527 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015090 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027863 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300029625 | Mildly acidic thermal spring sediment microbial community from Yellowstone National Park, USA - SJ3 Spring | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030873 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E1_02440010 | 2170459002 | Grass Soil | GMFFRAQPHYVLLDGNLFPDHESPPSLPCGDRDSEVAVIFNDGSD |
| JGI12662J13196_10220852 | 3300001081 | Forest Soil | ESIAFLRVEPDHVFLDGNLFPGHESPPSLSCRDRDSEIPVMINDGGD* |
| JGI12630J15595_100441271 | 3300001545 | Forest Soil | EPDHVFLDGNLFPGHESPPSLSCRDRDSEIPVMINDGGD* |
| Ga0065716_10165762 | 3300005277 | Arabidopsis Rhizosphere | LVESIAFLRVEPDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD* |
| Ga0070708_1009832053 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | EPDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD* |
| Ga0066706_112059761 | 3300005598 | Soil | PDHVFLDGDLFPGHESPPSLACGDRDSEIPVMINDEGD* |
| Ga0066903_1053173341 | 3300005764 | Tropical Forest Soil | PHYVLLDGNLFPDHESPPPLPCSDRDSEVAVIFNDGSD* |
| Ga0075023_1005577352 | 3300006041 | Watersheds | LLDGNLFPDHESPPSLPCSDRDSEVAIIFNDGSD* |
| Ga0066652_1002327601 | 3300006046 | Soil | AFLRAKPDHVFLDGNLFPGHESPPSLPCHDRDSEIPIMINDGGD* |
| Ga0075024_1007586221 | 3300006047 | Watersheds | HYVLLDGNLFPDHESPPSLPCGDRDSEVPVIFNDGSD* |
| Ga0075029_1007109013 | 3300006052 | Watersheds | RVEPDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD* |
| Ga0097691_10646931 | 3300006055 | Arctic Peat Soil | LLDGDLFPGHESPPSLACGDRDSEVAVIFNDGGD* |
| Ga0075026_1005155631 | 3300006057 | Watersheds | HVLLDGNLFPDHESPPSLPCGDRDSEVAVIFNDGSD* |
| Ga0075017_1002552714 | 3300006059 | Watersheds | HVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDVGD* |
| Ga0075019_110126783 | 3300006086 | Watersheds | IAFLRVEPDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD* |
| Ga0075018_107276751 | 3300006172 | Watersheds | QPHYVLLDGDLFPGHESPPSLACGDSDSEVAVIFNDGGD* |
| Ga0070712_1019854952 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VLLDGNLFPDHESPPSLPCGDRDSEVAVIFNDGSD* |
| Ga0070765_1017224841 | 3300006176 | Soil | HVFLDGNLFPGHESPPSLPCCDRDSEIPVMINDGGD* |
| Ga0070765_1017928722 | 3300006176 | Soil | PHYVLLDGNLFPDHESPPSLPWGDRDSEVAVIFNDGTD* |
| Ga0066659_108838154 | 3300006797 | Soil | LHVEPDHVFLDGDLFPGHESPPSLLCCDRDSEIPVMINDGGD* |
| Ga0099795_101207941 | 3300007788 | Vadose Zone Soil | HYVFLDGNHFPDHESPPSLPYGDRDSEVAVIFNDESD* |
| Ga0099829_105642361 | 3300009038 | Vadose Zone Soil | HYVFLDGNHFPDHESPPSLPYGDRDSEVAVIFNDGSD* |
| Ga0105242_110128721 | 3300009176 | Miscanthus Rhizosphere | PHYVLLDGDLFPGHESPPSLACGDRESEVAVIFNDGGD* |
| Ga0126319_10552211 | 3300010147 | Soil | DHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD* |
| Ga0126383_129410603 | 3300010398 | Tropical Forest Soil | GTFLRAQPHYVLLDGNLFPDHESPPSLAATESEIAVIFNDGGD* |
| Ga0137391_100886321 | 3300011270 | Vadose Zone Soil | VFLDGNHFPDHESPPSLPYGDRDSEVAVIFNDGSD* |
| Ga0137391_101637341 | 3300011270 | Vadose Zone Soil | VFLDGNLFRGHESPPSLACRDSDSENRVRFNDVSH* |
| Ga0137365_112479492 | 3300012201 | Vadose Zone Soil | VEPDHVFLDGNLFPGHESPPSLLCRDRDSEIPVMINDGGD* |
| Ga0137362_114173081 | 3300012205 | Vadose Zone Soil | FLDGNLFPGHESPPSPPCRDRDSEIPVMINDGGD* |
| Ga0137387_106415851 | 3300012349 | Vadose Zone Soil | PHNVFLDGNLFRGHESPPSLACRDSDSENRIRFNDVSH* |
| Ga0137371_114047981 | 3300012356 | Vadose Zone Soil | LRVEPDHVFLDGNLFPGHESPPSLPCRNRDSEIPVMINDGGD* |
| Ga0136633_11579971 | 3300012527 | Polar Desert Sand | ELLDGNLFPGHESPPSLLISDSDSEIPVQINDGGY* |
| Ga0137395_101814021 | 3300012917 | Vadose Zone Soil | FLDGNHFPDHESPPSLPYGDRDSEVAVIFNDGSD* |
| Ga0137359_101870481 | 3300012923 | Vadose Zone Soil | LLDGNLFPDHESPPSLPCGDRDSEVAVIFNDGSD* |
| Ga0137419_111544131 | 3300012925 | Vadose Zone Soil | LRAQPHYVFLDGNHFPDHESPPSLPYGDRDSEVAVIFNDGTD* |
| Ga0137410_114148771 | 3300012944 | Vadose Zone Soil | YVFLDGNHFPDHESPPSLPYGDRDSEVAVIFNDGSD* |
| Ga0181526_108188141 | 3300014200 | Bog | PHYVLPDGNLFPDHESPPSPPCGDRDSELAVIFNDGSD* |
| Ga0182013_100156921 | 3300014492 | Bog | AQPHHVFLDGDLSPGHESPPSLLRSNRDSEIAVEINDAGY* |
| Ga0182012_100812251 | 3300014499 | Bog | HVFLDGDLSPGHESPPSLLRSNRDSEIAVEINDAGY* |
| Ga0181536_103728471 | 3300014638 | Bog | PHNVFLDGNLFSGHESPPSLLRSDSDSELAAKINDRGH* |
| Ga0181522_109076451 | 3300014657 | Bog | NVFLDGDLFPDHESPPSLLHSERDSEAALRINDGGH* |
| Ga0182030_104855351 | 3300014838 | Bog | PRASRAQPHNVFLDGNLFPGHESPSSLLSSDSDSELAAKINDRGH* |
| Ga0182030_105979083 | 3300014838 | Bog | QPHHVFLDGDLSPGHESPPSLLRSNRDSEIAVEINDAGY* |
| Ga0157376_101515322 | 3300014969 | Miscanthus Rhizosphere | VFFRAQPHYVLLDGNLFPDHESPPSLPCGDRDSEVAVIFNDGSD* |
| Ga0157376_108351131 | 3300014969 | Miscanthus Rhizosphere | PDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD* |
| Ga0167634_10012234 | 3300015090 | Glacier Forefield Soil | YVLLDGKLFPDHESPPSLACSDRDSEAPVIFNDGGD* |
| Ga0182033_101414591 | 3300016319 | Soil | LVRAQPHNVFLGGDFFPGHESPPSLLRSNSDSELAVEINDGRH |
| Ga0182033_113103651 | 3300016319 | Soil | AQPHNVFLGGDFFPGHESPPSLLRSNSDSELAVEINDGWH |
| Ga0187808_105121971 | 3300017942 | Freshwater Sediment | YNILLDGNLLRGHESPPSFGRRNDSENCIRFNDVSN |
| Ga0187781_100772343 | 3300017972 | Tropical Peatland | AQPNHVFLDGDLFPGHESPPSLLCSDRDSELTVKSNDGTH |
| Ga0187773_112571152 | 3300018064 | Tropical Peatland | LLALVRAQPNHVFFDGDFIPGHESSPSLLPSDRDSELAIKSNDGGY |
| Ga0193732_10126991 | 3300020012 | Soil | AQPHNVFLDGNLFRGHESPPSLACRDSDSENRIRFNDVSH |
| Ga0194113_101338783 | 3300020074 | Freshwater Lake | AQPNHILLDGDLLPGHESSPSLLCSDRDSELAVKSNDGGH |
| Ga0194111_100114231 | 3300020083 | Freshwater Lake | PNHILLDGDLLPGHESSPSLLCSDRDSELAVKSNDGGH |
| Ga0194111_102888211 | 3300020083 | Freshwater Lake | RAQPNHILLDGDLLPGHESSPSLLCSDRDSELAVKSNDGGH |
| Ga0194119_100100561 | 3300020220 | Freshwater Lake | NHILLDGDLLPGHESSPSLLCSDRDSELAVKSNDGGH |
| Ga0194119_104396181 | 3300020220 | Freshwater Lake | QPNHILLDGDLLPGHESSPSLLCSDRDSELAVKSNDGGH |
| Ga0194125_106359222 | 3300020222 | Freshwater Lake | ILLDGDLLPGHESSPSLLCSDRDSELAVKSNDGGH |
| Ga0210407_106183581 | 3300020579 | Soil | PDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD |
| Ga0210401_109530032 | 3300020583 | Soil | RGQPHYVFLDGDLFPGHESPPSLACGDSDSEVAVIFNDGGD |
| Ga0194126_100156161 | 3300020603 | Freshwater Lake | HILLDGDLLPGHESSPSLLCSDRDSELAVKSNDGGH |
| Ga0179596_106838182 | 3300021086 | Vadose Zone Soil | PHYVFLDGNHFPDHESPPSLPYGDRDSEVAVIFNDESD |
| Ga0210406_109819861 | 3300021168 | Soil | EPDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD |
| Ga0193719_100771155 | 3300021344 | Soil | RAQPHNVFLDGNLFRGHESPPSLACRDSDSENRIRFNDVSH |
| Ga0210387_103653931 | 3300021405 | Soil | HVFFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD |
| Ga0210392_106679461 | 3300021475 | Soil | PHYVLLDGNLFPDHESPPSLPCSDRDSEVAVIFNDGSD |
| Ga0210402_109443421 | 3300021478 | Soil | VLLDGNLFPDHESPPSLPCSDRDSEVAVIFNDGSD |
| Ga0213851_17645811 | 3300021860 | Watersheds | PHDVFLDGNLFPDHESPQSLLPSESDSEVHGIFNDASD |
| Ga0207680_107565422 | 3300025903 | Switchgrass Rhizosphere | VEPDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD |
| Ga0207663_110668642 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | QPHYVLLDGNLFPDHESPPSLPCGDRDSEVAVIFNDGSD |
| Ga0207646_116141651 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | DHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD |
| Ga0257172_10303431 | 3300026482 | Soil | RGQPHYVLLDGDLFPGHESPPSLACGDRDSEVAVIFNDGGD |
| Ga0257157_10640451 | 3300026496 | Soil | AQPHNVFLDGNLFRGHESPPSLACRDSDSENRVRFNDVSH |
| Ga0209180_101864632 | 3300027846 | Vadose Zone Soil | AQPHYVFLDGNHFPDHESPPSLPYGDRDSEVAVIFNDGSD |
| Ga0207433_100991565 | 3300027863 | Hot Spring | RAQPNNVFLDGDLLPGHESPPSLLLSGRDSQLAIKSNDGGY |
| Ga0209068_102477203 | 3300027894 | Watersheds | RTQPDHVFLDGDLFPGHESPPSLACRDRDSEIPVTINDESD |
| Ga0209067_106043531 | 3300027898 | Watersheds | QPHYVLLDGDLFPGHESPPPLACGDRDSEIAVIFNDGGD |
| Ga0209488_100732711 | 3300027903 | Vadose Zone Soil | VFLDGNHFPDHESPPSLPYGDRDSEVAVIFNDESD |
| Ga0209526_100378581 | 3300028047 | Forest Soil | VFLDGNLFPGHESPPSLSCRDRDSEIPVMINDGGD |
| Ga0247684_10055811 | 3300028138 | Soil | TFLRAQPHYVLLDGNLFPDHESPPSLPCSNRDSEVAVIFNDEGD |
| Ga0307296_105922901 | 3300028819 | Soil | AQPHYVLLDGNLFPHHESSPSLPCGDRDSEVTVIFNDESD |
| Ga0311297_10887461 | 3300029625 | Hot Spring | RDKLFPLIRAQPHNVFLDGNFFPGHEPPPALIDSDSDSELGVEINDRGH |
| Ga0311340_100591794 | 3300029943 | Palsa | LLDGNLFPDHESPPSLPCAGDRDSEVAVIFNDGSD |
| Ga0265751_1079151 | 3300030873 | Soil | VEPDHVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGDSL |
| Ga0170834_1008459841 | 3300031057 | Forest Soil | HYVFLDGDLFPGHESPPSLACGDRDSEVAVIFNDGGD |
| Ga0170834_1109895572 | 3300031057 | Forest Soil | FLRGQPHYVFLDGDLFPGHESPPSLACGDRDSQVAVIFNDGGD |
| Ga0307498_100249883 | 3300031170 | Soil | HYVFLDGNLFPDHESPPSLPCGDRDSEVAVIFNDGSD |
| Ga0170824_1071461141 | 3300031231 | Forest Soil | HVFLDGNLFPGHESPPSLPCRDRDSEIPVMINDGGD |
| Ga0302320_107135511 | 3300031524 | Bog | QTHDVFFNGDFFPGHESSPSLINSNRDSELTTEINDGGH |
| Ga0318541_103118933 | 3300031545 | Soil | LHYVLLDGNLFPDHESPLPSLPCSDRDSEVTVIFNDGSD |
| Ga0307375_104451151 | 3300031669 | Soil | LIAFLRAQPDHVFLDGDLFPGHESPPSLACGDRDSEIPVTINDESD |
| Ga0306925_117439371 | 3300031890 | Soil | RVEPDHVFLDRNLFPRHESSPSLPRGDRDSEVPIIFNDGDD |
| Ga0306921_112555451 | 3300031912 | Soil | VLLDGDLFPGHESPPSLACGDRDSEIAIIFNDGGD |
| Ga0310916_109108601 | 3300031942 | Soil | TFLCGQPHDVLLDGDLFPGHESPPSLACGDRDSEIAVIFNDGGD |
| Ga0310909_102005101 | 3300031947 | Soil | YVLLDGNLFPDHESPPSLPCSDRDSEVAVIFNDGSD |
| Ga0306920_1017765571 | 3300032261 | Soil | FFRGQPHYVLLDGDLFPGHESPPSLACGDRDSEIAIIFNDGGD |
| Ga0315273_132164732 | 3300032516 | Sediment | QPHNIFLDGNLFPGHESPPALLQGSDSENLVRLNDATD |
| Ga0326728_101490004 | 3300033402 | Peat Soil | PNHVFLYGDLFPGHESPPSLLRSGSDSELTIKSNDAGY |
| Ga0326728_104376561 | 3300033402 | Peat Soil | VFLDGDLFPGHESPPPLLCRDRDSELAVKSNDGNH |
| Ga0326728_107103152 | 3300033402 | Peat Soil | VQPNHVFLYGDLFPGHESPPSLLRSGSDSELTIKSNDAGY |
| Ga0326727_103593491 | 3300033405 | Peat Soil | ALLRAQPNHVFLDGDLFPGHESPPPLLCRDRDSELAVKSNDGNH |
| Ga0326727_104335813 | 3300033405 | Peat Soil | NHVFLYGDLFPGHESPPSLLRSGSDSELTIKSNDAGY |
| Ga0326727_105147752 | 3300033405 | Peat Soil | HVFLYGDLFPGHESPPSLLRSGSDSELTIKSNDAGY |
| Ga0326727_105481303 | 3300033405 | Peat Soil | RVQPNHVFLYGDLFPGHESPPSLLRSGSDSELTIKSNDAGY |
| ⦗Top⦘ |