


| Basic Information | |
|---|---|
| Family ID | F097941 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MHVKYTSEKLTKIVIVSAIFWLFLLLALSMADYATRLWT |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.15 % |
| % of genes from short scaffolds (< 2000 bps) | 90.38 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.385 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.385 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.923 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.885 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF01565 | FAD_binding_4 | 25.00 |
| PF13240 | zinc_ribbon_2 | 21.15 |
| PF12838 | Fer4_7 | 10.58 |
| PF13248 | zf-ribbon_3 | 5.77 |
| PF00106 | adh_short | 0.96 |
| PF04255 | DUF433 | 0.96 |
| PF07244 | POTRA | 0.96 |
| PF13414 | TPR_11 | 0.96 |
| PF02812 | ELFV_dehydrog_N | 0.96 |
| PF00510 | COX3 | 0.96 |
| PF13432 | TPR_16 | 0.96 |
| PF01609 | DDE_Tnp_1 | 0.96 |
| PF02913 | FAD-oxidase_C | 0.96 |
| PF14534 | DUF4440 | 0.96 |
| PF13183 | Fer4_8 | 0.96 |
| PF00115 | COX1 | 0.96 |
| PF02424 | ApbE | 0.96 |
| PF13534 | Fer4_17 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.96 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.96 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.96 |
| COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 0.96 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.96 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.96 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.96 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.38 % |
| Unclassified | root | N/A | 34.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002561|JGI25384J37096_10265042 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005187|Ga0066675_10375440 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300005344|Ga0070661_100080667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2401 | Open in IMG/M |
| 3300005434|Ga0070709_11721178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 512 | Open in IMG/M |
| 3300005445|Ga0070708_101803685 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005534|Ga0070735_10175086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1322 | Open in IMG/M |
| 3300005552|Ga0066701_10444103 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300005554|Ga0066661_10673619 | Not Available | 609 | Open in IMG/M |
| 3300005555|Ga0066692_10078642 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
| 3300005566|Ga0066693_10466259 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005602|Ga0070762_10010749 | All Organisms → cellular organisms → Bacteria | 4588 | Open in IMG/M |
| 3300005610|Ga0070763_10269847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300005712|Ga0070764_10080779 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
| 3300005712|Ga0070764_10618570 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005764|Ga0066903_103868212 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300005944|Ga0066788_10050388 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300006041|Ga0075023_100480948 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300006047|Ga0075024_100230520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300006173|Ga0070716_100101610 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
| 3300006176|Ga0070765_100017705 | All Organisms → cellular organisms → Bacteria | 5231 | Open in IMG/M |
| 3300006871|Ga0075434_101905351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 600 | Open in IMG/M |
| 3300009038|Ga0099829_10131174 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300009088|Ga0099830_10387343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1129 | Open in IMG/M |
| 3300009637|Ga0116118_1256638 | Not Available | 535 | Open in IMG/M |
| 3300009665|Ga0116135_1422442 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300009683|Ga0116224_10285271 | Not Available | 786 | Open in IMG/M |
| 3300009700|Ga0116217_10276688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1084 | Open in IMG/M |
| 3300009700|Ga0116217_11032731 | Not Available | 503 | Open in IMG/M |
| 3300009759|Ga0116101_1166293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300010303|Ga0134082_10456137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300010329|Ga0134111_10282292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300010337|Ga0134062_10755308 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010376|Ga0126381_102871309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300011077|Ga0138572_1102848 | Not Available | 825 | Open in IMG/M |
| 3300011270|Ga0137391_10934627 | Not Available | 708 | Open in IMG/M |
| 3300012189|Ga0137388_11635974 | Not Available | 579 | Open in IMG/M |
| 3300012189|Ga0137388_11899832 | Not Available | 525 | Open in IMG/M |
| 3300012205|Ga0137362_10287025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1424 | Open in IMG/M |
| 3300012360|Ga0137375_10836797 | Not Available | 737 | Open in IMG/M |
| 3300012362|Ga0137361_10353756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1348 | Open in IMG/M |
| 3300012582|Ga0137358_10929847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300012918|Ga0137396_10957834 | Not Available | 623 | Open in IMG/M |
| 3300012922|Ga0137394_11276295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300012929|Ga0137404_11972559 | Not Available | 544 | Open in IMG/M |
| 3300012944|Ga0137410_11569700 | Not Available | 576 | Open in IMG/M |
| 3300012944|Ga0137410_11935531 | Not Available | 523 | Open in IMG/M |
| 3300012957|Ga0164303_11535014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300015052|Ga0137411_1171861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium | 818 | Open in IMG/M |
| 3300015089|Ga0167643_1038993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300015199|Ga0167647_1078276 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300017933|Ga0187801_10031741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1856 | Open in IMG/M |
| 3300017936|Ga0187821_10002346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6038 | Open in IMG/M |
| 3300017943|Ga0187819_10089877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1834 | Open in IMG/M |
| 3300017966|Ga0187776_11623548 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300017972|Ga0187781_11151954 | Not Available | 570 | Open in IMG/M |
| 3300018012|Ga0187810_10210822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300018017|Ga0187872_10265620 | Not Available | 763 | Open in IMG/M |
| 3300018022|Ga0187864_10355182 | Not Available | 641 | Open in IMG/M |
| 3300018043|Ga0187887_10581351 | Not Available | 661 | Open in IMG/M |
| 3300018088|Ga0187771_10008278 | All Organisms → cellular organisms → Bacteria | 7451 | Open in IMG/M |
| 3300018088|Ga0187771_10579244 | Not Available | 951 | Open in IMG/M |
| 3300018090|Ga0187770_10863052 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300018468|Ga0066662_10814781 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300020581|Ga0210399_10163849 | Not Available | 1842 | Open in IMG/M |
| 3300020581|Ga0210399_10353973 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300021170|Ga0210400_10764593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300021178|Ga0210408_10319718 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300021559|Ga0210409_10821542 | Not Available | 802 | Open in IMG/M |
| 3300021560|Ga0126371_11387988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300025612|Ga0208691_1138206 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300025922|Ga0207646_11100313 | Not Available | 699 | Open in IMG/M |
| 3300025927|Ga0207687_11855078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300025929|Ga0207664_11981475 | Not Available | 505 | Open in IMG/M |
| 3300025934|Ga0207686_10138083 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300025981|Ga0207640_11997872 | Not Available | 525 | Open in IMG/M |
| 3300025986|Ga0207658_11586017 | Not Available | 598 | Open in IMG/M |
| 3300026078|Ga0207702_12025859 | Not Available | 566 | Open in IMG/M |
| 3300026215|Ga0209849_1032490 | Not Available | 902 | Open in IMG/M |
| 3300026317|Ga0209154_1209411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300026318|Ga0209471_1126010 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300026358|Ga0257166_1035498 | Not Available | 690 | Open in IMG/M |
| 3300026514|Ga0257168_1153447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300026528|Ga0209378_1102035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1265 | Open in IMG/M |
| 3300026538|Ga0209056_10273256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
| 3300027680|Ga0207826_1056408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1086 | Open in IMG/M |
| 3300027812|Ga0209656_10045584 | All Organisms → cellular organisms → Bacteria | 2510 | Open in IMG/M |
| 3300027862|Ga0209701_10076590 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300027879|Ga0209169_10364320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300027986|Ga0209168_10127733 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300028016|Ga0265354_1006154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300028047|Ga0209526_10546442 | Not Available | 749 | Open in IMG/M |
| 3300029817|Ga0247275_1001431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 19453 | Open in IMG/M |
| 3300030659|Ga0316363_10092798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1352 | Open in IMG/M |
| 3300030707|Ga0310038_10337367 | Not Available | 670 | Open in IMG/M |
| 3300031718|Ga0307474_10647652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300031720|Ga0307469_11549600 | Not Available | 636 | Open in IMG/M |
| 3300031912|Ga0306921_12621821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 520 | Open in IMG/M |
| 3300032001|Ga0306922_10080542 | All Organisms → cellular organisms → Bacteria | 3418 | Open in IMG/M |
| 3300032160|Ga0311301_12281093 | Not Available | 617 | Open in IMG/M |
| 3300032180|Ga0307471_103188107 | Not Available | 581 | Open in IMG/M |
| 3300032783|Ga0335079_10665927 | Not Available | 1091 | Open in IMG/M |
| 3300032893|Ga0335069_11216243 | Not Available | 824 | Open in IMG/M |
| 3300033158|Ga0335077_11413160 | Not Available | 670 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.65% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.77% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.81% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.92% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011077 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015199 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface) | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25384J37096_102650422 | 3300002561 | Grasslands Soil | FFMHVRYTSEKLTAMVIVSALFWLLILLTLSLADYSTRPIG* |
| Ga0066675_103754403 | 3300005187 | Soil | MHLKYTSEKMTSVVVISALFWLLILLALSLADYTTRPLGVN* |
| Ga0070661_1000806673 | 3300005344 | Corn Rhizosphere | VLIFMHVKYASERLVKAVVVSAIFFLLLLLGLSLADYTTRLL* |
| Ga0070709_117211782 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | FFMHVKYTHERLTPLVIVSALFFLGLLLSLSMADFGTRGWH* |
| Ga0070708_1018036851 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LFFMHVKYTSEKLTAMVIVSALFWLLILLTLSLADYSTRPIG* |
| Ga0070735_101750861 | 3300005534 | Surface Soil | VKYTSERLTKIVIVSAMFWLFLLLGLSMADYVTRFLS* |
| Ga0066701_104441032 | 3300005552 | Soil | VLFFMHVKYTSERLTKMVIVSALFWMFILLSLSMADYATRLWK* |
| Ga0066661_106736191 | 3300005554 | Soil | KYTHEKMTGLVVASAIFWLFILLALSMADYTTRLWR* |
| Ga0066692_100786421 | 3300005555 | Soil | LKYTSEKMTSVVVISALFWLLILLALSLADYTTRPLGVN* |
| Ga0066693_104662591 | 3300005566 | Soil | TSEKLTTMVIVSALFWLLILLALSLADYSTRPIS* |
| Ga0070762_100107491 | 3300005602 | Soil | VKYTSEKLTKIVIVSAIFWLFLLLALSMADYATRLWT* |
| Ga0070763_102698473 | 3300005610 | Soil | YTSEKLTKIVIVSAIFWLFLLLALSMADYATRLWT* |
| Ga0070764_100807791 | 3300005712 | Soil | HVKYTSEKLTKIVIVSAIFWLFLLLALSMADYATRLLS* |
| Ga0070764_106185702 | 3300005712 | Soil | FFMHVKYASEKLTKMVIVASIFWLLLLLLLSLADYGTRYARHG* |
| Ga0066903_1038682121 | 3300005764 | Tropical Forest Soil | KYAHDKITKVVIVAALFWLAILLALSMADYTTRLWT* |
| Ga0066788_100503883 | 3300005944 | Soil | VKYISDRLTKMVVVAVIFWLFLLLGLSLMDYGTRHFG* |
| Ga0075023_1004809482 | 3300006041 | Watersheds | VLIFMHVKYTSEKLTKAVIISAIFFLGLLLTLSLADFGTRAWL* |
| Ga0075024_1002305201 | 3300006047 | Watersheds | IFMHVKYTSDKLVKVVVISAVFFLLLLLGLSLADYTTRLLM* |
| Ga0070716_1001016101 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LIFMHVKYTSDRLVKVVVISAVFFLLLLLGLSLADYTTRLLM* |
| Ga0070765_1000177054 | 3300006176 | Soil | TSEKLTKIVIVSAIFWLFLLLALSMADYATRLWT* |
| Ga0075434_1019053511 | 3300006871 | Populus Rhizosphere | MHVKGASEKMTKVVIFSGIFFLLLLLTLTMADYGTRLWT* |
| Ga0099829_101311742 | 3300009038 | Vadose Zone Soil | VVLFFMHVKYTHEKLTGLVVLSAIFWLFVLLALSMADYATRLWR* |
| Ga0099830_103873433 | 3300009088 | Vadose Zone Soil | KYTSEKLTKMVIASAMFWLFILLSLSMADYATRLWK* |
| Ga0116118_12566381 | 3300009637 | Peatland | KYTHEKLTGLVIVSAIFFLFILLALSMADYTTRLWR* |
| Ga0116135_14224422 | 3300009665 | Peatland | LFFMHVKYASEKLTKLVIASAIFFLILLLSLSMIDYLTRYLA* |
| Ga0116224_102852712 | 3300009683 | Peatlands Soil | LFYMHVKYTHEKLTGLVIVSAIFFLFILLALSMADYTTRLWR* |
| Ga0116217_102766881 | 3300009700 | Peatlands Soil | KYTSEKMTKVVVVSAIFWLLTLLALSLADYTTRLLA* |
| Ga0116217_110327312 | 3300009700 | Peatlands Soil | YTSEKLTKIVIVSAIFWLLLLLALSMADYTTRLWT* |
| Ga0116101_11662931 | 3300009759 | Peatland | LFFMHVKYTSEKLTKIVIVSAIFWLFLLLALSMADYATRLLS* |
| Ga0134082_104561372 | 3300010303 | Grasslands Soil | HLKYTSERMTSVVVVSALFWLLILLALSLADYTTRPLGVN* |
| Ga0134111_102822922 | 3300010329 | Grasslands Soil | FMHLKYTSEKMTSVVVISAIVHVLILLALSLADYSTLPLGVS* |
| Ga0134062_107553081 | 3300010337 | Grasslands Soil | MHVKYTSEKLTAMVIVSALFWLLILLTLSLADYSTRPIG* |
| Ga0074044_100147666 | 3300010343 | Bog Forest Soil | MHVKYSSERLTKVVIVSSVFWLVILLLLSLADYSTRGNVRIM* |
| Ga0126381_1028713091 | 3300010376 | Tropical Forest Soil | KYTSEKMTKVVIACALFWLLILLALSMTDYATRHLA* |
| Ga0138572_11028481 | 3300011077 | Peatlands Soil | THEKLTGLVIVSAIFFLFILLALSMADYTTRLWR* |
| Ga0137391_109346272 | 3300011270 | Vadose Zone Soil | VLIFMHVKYASEKLIKVVVISAVFFLMLLLGLSLADYTTRMLM* |
| Ga0137388_116359741 | 3300012189 | Vadose Zone Soil | LFFMHVKYTHEKMTGLVVASAIFWLFILLALSMADYTTRLWR* |
| Ga0137388_118998321 | 3300012189 | Vadose Zone Soil | KYTHEKLTGLVVLSAIFWLFVLLALSMADYTTRLWR* |
| Ga0137362_102870251 | 3300012205 | Vadose Zone Soil | KYTSEKMTSVVVISALFWLLILLALSLADYTTRPLGVN* |
| Ga0137375_108367972 | 3300012360 | Vadose Zone Soil | VKYAHEKMTKLVIVTGIFFLFILLALSMADYGTRLWS* |
| Ga0137361_103537561 | 3300012362 | Vadose Zone Soil | LFFMHVKYAHEKMTKLVIVTAIFFLFILLALSMADYGTRLWS* |
| Ga0137358_109298471 | 3300012582 | Vadose Zone Soil | MHVKYTHEKLTGLVVVSAIFWLFVLLALSMADYTTRLWR* |
| Ga0137396_109578342 | 3300012918 | Vadose Zone Soil | MHVKYTHEKLTGLVVASAIFWLFILLALSMADYTTRLWR* |
| Ga0137394_112762952 | 3300012922 | Vadose Zone Soil | LFFMHLKYTSEKMTSVVVISALFWLLILLALSLADYTTRPLGVN* |
| Ga0137404_119725591 | 3300012929 | Vadose Zone Soil | IFMHVKYTSEKLVKAVVLSAVFFLLLLLGLSLADYTTRLLM* |
| Ga0137410_115697002 | 3300012944 | Vadose Zone Soil | KYASDKLVKVVVISALFFLMLLLGLSLADYSTRLL* |
| Ga0137410_119355312 | 3300012944 | Vadose Zone Soil | MHVKYAHEKMTKLVIVTGIFFLFILLALSMADYGTRLWS* |
| Ga0164303_115350141 | 3300012957 | Soil | KYTSEKLVKVVVISAIFFLLLLLGLSLADYTTRLLM* |
| Ga0137411_11718611 | 3300015052 | Vadose Zone Soil | VVLFFMHVKYTSERMTKAKVVIVAAIFWLLLLLGLSLADYATRLRG* |
| Ga0167643_10389931 | 3300015089 | Glacier Forefield Soil | HVKYTSEKLTKVVIVSAIFFLVILLSLSMADYGTRLMQ* |
| Ga0167647_10782763 | 3300015199 | Glacier Forefield Soil | IFMHVKYTSEKLTKLVVISAVFWLFILLALSLFDYGTRTLG* |
| Ga0187801_100317413 | 3300017933 | Freshwater Sediment | FMHVKYTSEKLTKIVIASAIFWLFLLLALSMADYGTRFLS |
| Ga0187821_100023461 | 3300017936 | Freshwater Sediment | YASDRLTKVVLISALFWLFLLLGLSLADYTTRALR |
| Ga0187819_100898773 | 3300017943 | Freshwater Sediment | LFFMHVKYTSEKLTKIVIASAIFWLFLLLALSMADYGTRLLS |
| Ga0187776_116235482 | 3300017966 | Tropical Peatland | LVVLFFMHVKYTHERLTPLVILSAIFFLGLLLALSMADYGTRLWH |
| Ga0187781_111519541 | 3300017972 | Tropical Peatland | VKYASEKLTKVVIISSVFWLLLLLILSLADYSTRGNVRIM |
| Ga0187810_102108221 | 3300018012 | Freshwater Sediment | LFFMHVKYTSEKLTKIVIISSIFWLLLLLALSMADYTTRLIS |
| Ga0187872_102656201 | 3300018017 | Peatland | YMHVKYTHEKLTGLVIVSAIFFLFILLALSMADYTTRLWR |
| Ga0187864_103551821 | 3300018022 | Peatland | KYTHEKLTGLVIVSAIFFLFILLALSMADYTTRLWR |
| Ga0187887_105813511 | 3300018043 | Peatland | VVLFFMHVKYTHEKLTGLVVVSAIFWLGLLLGLSMLDYGTRLWQ |
| Ga0187771_100082781 | 3300018088 | Tropical Peatland | HVKYASEKLTKMVIVSALFWLLILLFLSLADYTTRGIGHA |
| Ga0187771_105792442 | 3300018088 | Tropical Peatland | MHVKYASEKLTKVVILSSLFWLILLLVLSLADYSTRSVHAM |
| Ga0187770_108630522 | 3300018090 | Tropical Peatland | VKYTSEKLTKLVIVASIFWLLVLLFLSLADYSTRYGHA |
| Ga0066662_108147812 | 3300018468 | Grasslands Soil | YTSEKLTAMVIVSALFWLLILLTLSLADYSTRPIG |
| Ga0210399_101638492 | 3300020581 | Soil | FMHVKYAHERLTKLVIVTAIFFFLILLTLSMADYATRLWT |
| Ga0210399_103539733 | 3300020581 | Soil | VRYASDKLIKVVVVSALFFLLLLLGLSLADYSTRMLA |
| Ga0210400_107645932 | 3300021170 | Soil | YTHEKLTKMVIATAIFFFLILLVLSMADYGTRLWT |
| Ga0210408_103197183 | 3300021178 | Soil | LLVVMIFMHVRYASDKLIKVVVVSALFFLLLLLGLSLADYSTRMLA |
| Ga0210409_108215422 | 3300021559 | Soil | FMHVKYTSEKLTKIVIVAAIFWLFLLLALSMADYATRLWT |
| Ga0126371_113879881 | 3300021560 | Tropical Forest Soil | YGTSERMTKVVIVSGLFFLMLLLGLSLADYATRAWS |
| Ga0208691_11382061 | 3300025612 | Peatland | VLFFMHVKYASEKLTKLVIASAIFFLILLLSLSMIDYLTRYLA |
| Ga0207646_111003131 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | HVKYTHEKMTGLVVASAIFWLFILLALSMADYTTRLWR |
| Ga0207687_118550782 | 3300025927 | Miscanthus Rhizosphere | IFMHVKYTSEKLVKVVVISAIFFLLLLLGLSLADYTTRLLM |
| Ga0207664_119814752 | 3300025929 | Agricultural Soil | FMHVKYAHDKMTKVVIVAALFWLAILLALSMADYTTRLWT |
| Ga0207686_101380833 | 3300025934 | Miscanthus Rhizosphere | FMHVKYASERLVKVVVVSAIFFLLLLLGLSLADYTTRLL |
| Ga0207640_119978722 | 3300025981 | Corn Rhizosphere | VKYTSEKLTKTVGLATLFWLALLLFLTLTDYATRGVPS |
| Ga0207658_115860171 | 3300025986 | Switchgrass Rhizosphere | KYASERLVKAVVVSAIFFLLLLLGLSLADYTTRLL |
| Ga0207702_120258592 | 3300026078 | Corn Rhizosphere | HVKYTSDSLVKVVVISAVFFLLLLLGLSLADYTTRLLM |
| Ga0209849_10324902 | 3300026215 | Soil | MHVKYISDRLTKMVVVAVIFWLFLLLGLSLMDYGTRHFG |
| Ga0209154_12094111 | 3300026317 | Soil | KYTSEKMTSVVVISALFWLLILLALSLADYTTRPLGVN |
| Ga0209471_11260101 | 3300026318 | Soil | VVLFFMHVKYTSERLTVMVIVSALFWLLILLTLSLADYSTRPIG |
| Ga0257166_10354981 | 3300026358 | Soil | FFMHVKYTHEKLTGLVVVSAIFWLFVLLALSMADYTTRLWR |
| Ga0257168_11534471 | 3300026514 | Soil | FMHVKYTHEKLTGLVVVSAIFWLFILLALSMADYTTRLWR |
| Ga0209378_11020351 | 3300026528 | Soil | HLKYTSEKMTSVVVISALFWLLILLALSLADYTTRPLGVN |
| Ga0209056_102732561 | 3300026538 | Soil | HLKYTNEKMTSVVVISALFWLLILLALSLADYSTRPLGVS |
| Ga0207826_10564083 | 3300027680 | Tropical Forest Soil | MHVKYTHEKLVPLVSVSAIFFMGLLLALSMADYGTRFWQ |
| Ga0209656_100455841 | 3300027812 | Bog Forest Soil | FFMHVKYTSEKLTKIVIVSAIFWLLLLLVLSMADYATRLLA |
| Ga0209701_100765902 | 3300027862 | Vadose Zone Soil | LFFMHVKYTSEKLTKMVIASAMFWLFILLSLSMADYATRLWK |
| Ga0209169_103643201 | 3300027879 | Soil | LFFLHVKYTSEKLTKIVIVSAIFWLFLLLALSMADYATRLLS |
| Ga0209168_101277333 | 3300027986 | Surface Soil | VKYTSERLTKIVIVSAMFWLFLLLGLSMADYVTRFLS |
| Ga0265354_10061541 | 3300028016 | Rhizosphere | MHVKYTSEKLTKIVIVSAIFWLFLLLALSMADYATRLWT |
| Ga0209526_105464422 | 3300028047 | Forest Soil | MHVKYTHEKLTGLVVVSAIFWLFVLLALSMADYTTRLWR |
| Ga0247275_100143118 | 3300029817 | Soil | YTHEKLTGLVIVSAIFFLFILLALSMADYTTRLWR |
| Ga0316363_100927981 | 3300030659 | Peatlands Soil | VVLFFMHVKYTSEKLTKIVITAAIFWLFLLLALSMADYGTRFLS |
| Ga0310038_103373671 | 3300030707 | Peatlands Soil | KYTSEKMTKVVVVSAIFWLLTLLALSLADYTTRLLA |
| Ga0307474_106476522 | 3300031718 | Hardwood Forest Soil | VLFFMHVKYTSERLTKIVIVSAIFWLFLLLALSMADYATRFLS |
| Ga0307469_115496001 | 3300031720 | Hardwood Forest Soil | VKYLSERLVKVVVISALFFLLLLLGLSLADYTTRLLA |
| Ga0306921_126218211 | 3300031912 | Soil | HVKYAHEKMTKLVIMTAIFFFLILLALTMADYGTRLWT |
| Ga0306922_100805423 | 3300032001 | Soil | HVKYTHEKLVPLVIVSAIFFLFLLLGLSMADYATRLWH |
| Ga0311301_122810932 | 3300032160 | Peatlands Soil | FFMHVKYTHEKLTGLVIASAILFLFILLSLSMADYATRYWQ |
| Ga0307471_1031881071 | 3300032180 | Hardwood Forest Soil | YTHEKMTGLVVASAIFWLFILLALSMADYTTRLWR |
| Ga0335079_106659273 | 3300032783 | Soil | FFMHAKYTSERMTKVVIAAGIFFLLLLLGLSLADYTTRL |
| Ga0335069_112162431 | 3300032893 | Soil | KYTSEKLTKVVIVSGIFFLLLLLGLSLADYSTRLIG |
| Ga0335077_114131602 | 3300033158 | Soil | YTSEKLTKMVIVSSIFWLLLLLGLSMADYTTRLIG |
| ⦗Top⦘ |