


| Basic Information | |
|---|---|
| Family ID | F097912 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MADIQRISVQQAHAKTKANQALLVCAYEDEAKCRMLNLDGS |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 96.15 % |
| % of genes near scaffold ends (potentially truncated) | 93.27 % |
| % of genes from short scaffolds (< 2000 bps) | 90.38 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.269 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.846 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.154 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.04% β-sheet: 11.59% Coil/Unstructured: 75.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF04679 | DNA_ligase_A_C | 2.88 |
| PF13561 | adh_short_C2 | 1.92 |
| PF01734 | Patatin | 1.92 |
| PF03631 | Virul_fac_BrkB | 1.92 |
| PF00069 | Pkinase | 1.92 |
| PF00216 | Bac_DNA_binding | 1.92 |
| PF00581 | Rhodanese | 0.96 |
| PF14022 | DUF4238 | 0.96 |
| PF10754 | DUF2569 | 0.96 |
| PF02837 | Glyco_hydro_2_N | 0.96 |
| PF13602 | ADH_zinc_N_2 | 0.96 |
| PF02614 | UxaC | 0.96 |
| PF03544 | TonB_C | 0.96 |
| PF02371 | Transposase_20 | 0.96 |
| PF13518 | HTH_28 | 0.96 |
| PF08388 | GIIM | 0.96 |
| PF02630 | SCO1-SenC | 0.96 |
| PF13414 | TPR_11 | 0.96 |
| PF09720 | Unstab_antitox | 0.96 |
| PF07521 | RMMBL | 0.96 |
| PF14534 | DUF4440 | 0.96 |
| PF02518 | HATPase_c | 0.96 |
| PF10996 | Beta-Casp | 0.96 |
| PF01068 | DNA_ligase_A_M | 0.96 |
| PF01545 | Cation_efflux | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 7.69 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 3.85 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.92 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 1.92 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 1.92 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 1.92 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 1.92 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.96 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.96 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.96 |
| COG1904 | Glucuronate isomerase | Carbohydrate transport and metabolism [G] | 0.96 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.96 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.27 % |
| Unclassified | root | N/A | 31.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17295543 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300000955|JGI1027J12803_100493307 | All Organisms → cellular organisms → Bacteria | 3430 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101117351 | Not Available | 675 | Open in IMG/M |
| 3300004080|Ga0062385_10315149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300004092|Ga0062389_100682565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
| 3300004268|Ga0066398_10113467 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005174|Ga0066680_10655233 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005174|Ga0066680_10667336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
| 3300005180|Ga0066685_10763042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae → Desulfuromonas → unclassified Desulfuromonas → Desulfuromonas sp. TF | 658 | Open in IMG/M |
| 3300005180|Ga0066685_11130871 | All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → Synergistaceae → Acetomicrobium → Acetomicrobium thermoterrenum | 511 | Open in IMG/M |
| 3300005332|Ga0066388_103630950 | Not Available | 788 | Open in IMG/M |
| 3300005440|Ga0070705_101282332 | Not Available | 607 | Open in IMG/M |
| 3300005445|Ga0070708_100419052 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300005445|Ga0070708_100741907 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300005555|Ga0066692_10985955 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005559|Ga0066700_10792025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
| 3300005560|Ga0066670_10820899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300005586|Ga0066691_10618616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300005598|Ga0066706_11384864 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005602|Ga0070762_10147338 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300005764|Ga0066903_101435825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1298 | Open in IMG/M |
| 3300005843|Ga0068860_101445945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300005921|Ga0070766_11200093 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300006173|Ga0070716_100607186 | Not Available | 824 | Open in IMG/M |
| 3300006903|Ga0075426_10313958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1148 | Open in IMG/M |
| 3300007258|Ga0099793_10330612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
| 3300009038|Ga0099829_10625054 | Not Available | 895 | Open in IMG/M |
| 3300009789|Ga0126307_10747005 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300010046|Ga0126384_12333001 | Not Available | 517 | Open in IMG/M |
| 3300010159|Ga0099796_10309775 | Not Available | 671 | Open in IMG/M |
| 3300011271|Ga0137393_10363931 | Not Available | 1236 | Open in IMG/M |
| 3300012096|Ga0137389_11089032 | Not Available | 685 | Open in IMG/M |
| 3300012198|Ga0137364_10297685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_2_20CM_53_11 | 1197 | Open in IMG/M |
| 3300012199|Ga0137383_11034948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Bryocella → Bryocella elongata | 597 | Open in IMG/M |
| 3300012202|Ga0137363_10645854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
| 3300012203|Ga0137399_10062207 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67 | 2767 | Open in IMG/M |
| 3300012203|Ga0137399_10167899 | Not Available | 1764 | Open in IMG/M |
| 3300012205|Ga0137362_10306628 | Not Available | 1375 | Open in IMG/M |
| 3300012205|Ga0137362_10974836 | Not Available | 722 | Open in IMG/M |
| 3300012211|Ga0137377_11919605 | Not Available | 509 | Open in IMG/M |
| 3300012361|Ga0137360_10148410 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300012362|Ga0137361_10346176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1364 | Open in IMG/M |
| 3300012582|Ga0137358_10799308 | Not Available | 626 | Open in IMG/M |
| 3300012683|Ga0137398_10776339 | Not Available | 669 | Open in IMG/M |
| 3300012685|Ga0137397_11153227 | Not Available | 561 | Open in IMG/M |
| 3300012917|Ga0137395_11063511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300012917|Ga0137395_11086476 | Not Available | 568 | Open in IMG/M |
| 3300012918|Ga0137396_10522112 | Not Available | 880 | Open in IMG/M |
| 3300012922|Ga0137394_11118373 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012922|Ga0137394_11142383 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300012923|Ga0137359_11782571 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012927|Ga0137416_10079196 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Firestonebacteria → Candidatus Firestonebacteria bacterium RIFOXYC2_FULL_39_67 | 2410 | Open in IMG/M |
| 3300012929|Ga0137404_10888648 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300012944|Ga0137410_11758362 | Not Available | 546 | Open in IMG/M |
| 3300012957|Ga0164303_10224605 | Not Available | 1058 | Open in IMG/M |
| 3300013308|Ga0157375_10810036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
| 3300014157|Ga0134078_10297913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 693 | Open in IMG/M |
| 3300015242|Ga0137412_10561318 | Not Available | 868 | Open in IMG/M |
| 3300015265|Ga0182005_1262024 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300015373|Ga0132257_104510739 | Not Available | 507 | Open in IMG/M |
| 3300016404|Ga0182037_10004154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 7907 | Open in IMG/M |
| 3300018433|Ga0066667_12131854 | Not Available | 520 | Open in IMG/M |
| 3300019786|Ga0182025_1155016 | All Organisms → cellular organisms → Bacteria | 2337 | Open in IMG/M |
| 3300020199|Ga0179592_10531737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300020581|Ga0210399_10060753 | All Organisms → cellular organisms → Bacteria | 3049 | Open in IMG/M |
| 3300021088|Ga0210404_10466167 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300021168|Ga0210406_10342045 | Not Available | 1208 | Open in IMG/M |
| 3300021168|Ga0210406_11004646 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300021171|Ga0210405_10096354 | All Organisms → cellular organisms → Bacteria | 2334 | Open in IMG/M |
| 3300021178|Ga0210408_11147172 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300021401|Ga0210393_10114166 | All Organisms → cellular organisms → Bacteria | 2156 | Open in IMG/M |
| 3300021433|Ga0210391_10339055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1179 | Open in IMG/M |
| 3300021477|Ga0210398_10340349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1223 | Open in IMG/M |
| 3300021478|Ga0210402_10396665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1281 | Open in IMG/M |
| 3300021559|Ga0210409_10492023 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300022756|Ga0222622_10293141 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300025910|Ga0207684_10499001 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300025961|Ga0207712_11951102 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300026035|Ga0207703_11382648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300026118|Ga0207675_100595382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300026320|Ga0209131_1261649 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300026332|Ga0209803_1226035 | Not Available | 659 | Open in IMG/M |
| 3300026557|Ga0179587_10098475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1766 | Open in IMG/M |
| 3300027629|Ga0209422_1151254 | Not Available | 520 | Open in IMG/M |
| 3300027654|Ga0209799_1010179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2008 | Open in IMG/M |
| 3300027660|Ga0209736_1034547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1489 | Open in IMG/M |
| 3300027727|Ga0209328_10092965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 921 | Open in IMG/M |
| 3300027889|Ga0209380_10766047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300027895|Ga0209624_10447668 | Not Available | 861 | Open in IMG/M |
| 3300028380|Ga0268265_10270928 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300028906|Ga0308309_10450669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1108 | Open in IMG/M |
| 3300031057|Ga0170834_100466992 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031128|Ga0170823_12087632 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300031708|Ga0310686_100256781 | Not Available | 883 | Open in IMG/M |
| 3300031708|Ga0310686_114008847 | All Organisms → cellular organisms → Bacteria | 7438 | Open in IMG/M |
| 3300031753|Ga0307477_10279640 | Not Available | 1154 | Open in IMG/M |
| 3300031942|Ga0310916_11648657 | Not Available | 520 | Open in IMG/M |
| 3300031959|Ga0318530_10200318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300031962|Ga0307479_10235601 | Not Available | 1805 | Open in IMG/M |
| 3300031962|Ga0307479_10292020 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1611 | Open in IMG/M |
| 3300031962|Ga0307479_10431479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1302 | Open in IMG/M |
| 3300032075|Ga0310890_10796168 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300032180|Ga0307471_102942394 | Not Available | 604 | Open in IMG/M |
| 3300032205|Ga0307472_100100480 | Not Available | 1988 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_01100000 | 2088090014 | Soil | MADMAHIERIDVKQAREKAHQALLVCAYENEAKHRMF |
| JGI1027J12803_1004933076 | 3300000955 | Soil | MVDIKRISAQQAHAKTKANQALLVCAYEDEAKCRMLNLDG |
| JGIcombinedJ26739_1011173512 | 3300002245 | Forest Soil | MADIQGIDAQQTHTKAKSNQALLVCAYEDEAKCRRLNLEGSIYRSPASSRG* |
| Ga0062385_103151491 | 3300004080 | Bog Forest Soil | MADIKRISVQQAHAKTEAKQALLVCAYEDEAKCRMLNLDGSISF |
| Ga0062389_1006825651 | 3300004092 | Bog Forest Soil | MSQGGQMADIKRISVQQAHAKTEAKQALLVCAYEDEAKCRMLNLD |
| Ga0066398_101134671 | 3300004268 | Tropical Forest Soil | MVDMADIERISVKQAREKAHQALLVCAYENEAKHRMSTSSIS* |
| Ga0066680_106552332 | 3300005174 | Soil | MADIKRISVQQAQAKTKANQALLVCAYEDEAKCRMLNLDGSISF |
| Ga0066680_106673362 | 3300005174 | Soil | MADVKRISVQQAYAKTNANQALLVCAYEDEAKCRMLNLDGSISF |
| Ga0066685_107630421 | 3300005180 | Soil | MADNQRISAQQAHAKSKAKQALLACAYEDEAKCRMLNLDGSISFA |
| Ga0066685_111308711 | 3300005180 | Soil | MADIKRISVQQAHAKTKANQALLVCAYEDEAKCRMLNLDGSISF |
| Ga0066388_1036309502 | 3300005332 | Tropical Forest Soil | MADISDMERISAKQAREKAHQALLVCAYENEVKHRMLNLDGSVSLANF |
| Ga0070705_1012823322 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MADMADIERIGVKQARGKAHQALLVCAYENEAKHRMFNLDGSISL |
| Ga0070708_1004190524 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MADMAHIERIDVKQAREKAHQALLVCAYENEAKHRMFNLDGSISL |
| Ga0070708_1007419072 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MADMADIERIGVKQARGKAHQALLVCAYENEAKHRMFNR* |
| Ga0066692_109859552 | 3300005555 | Soil | MADIKRISVQQAQAKTKANQALLVCAYEDEAKCRMLNLDGSISFA |
| Ga0066700_107920252 | 3300005559 | Soil | MADVKRISVQQAYAKTNANQALLVCAYEDEAKCRMLNLDGSIS |
| Ga0066670_108208992 | 3300005560 | Soil | MADVKRISVQQAYAKTNANQALLVCAYEDEAKCRMLNLDG |
| Ga0066691_106186162 | 3300005586 | Soil | MADVKRISVQQAYAKTNANQALLVCAYEDEAKCRMLNLDGSISFA |
| Ga0066706_113848641 | 3300005598 | Soil | MADIKRISVQQAYAKTKANQALLVCAYEDEAKCRMLNLDGSISFA |
| Ga0070762_101473383 | 3300005602 | Soil | MADIQRISVQQAHAKTKANQALLVCAYEDEAKCRM |
| Ga0066903_1014358252 | 3300005764 | Tropical Forest Soil | MADIERISVKQAREKAHQALLVCAYENEAKHRMFNLDGS |
| Ga0068860_1014459452 | 3300005843 | Switchgrass Rhizosphere | MADIERIGVKQAHEKVHQALLVCAYENEAKHRMFNLD |
| Ga0070766_112000931 | 3300005921 | Soil | MAEIQRISVQQAHAKTKANQALLVCAYEDEAKCQR |
| Ga0070716_1006071862 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MADMARISVKQARGKAHQALLVCAYENEAKHRMFNLDGSISLA |
| Ga0075426_103139584 | 3300006903 | Populus Rhizosphere | MADMADIERIGVKQARGKAHQALLVCAYENEAKHRMFNLDGSISLANFRS |
| Ga0099793_103306122 | 3300007258 | Vadose Zone Soil | MADIERISAQQAHAKTKANQALLVCAYEDEAKCRMLNLDGS |
| Ga0099829_106250541 | 3300009038 | Vadose Zone Soil | MADIQRISAQEAHTKTKANQALLVCAYEDEAKCRMLN |
| Ga0126307_107470052 | 3300009789 | Serpentine Soil | MADIERISVDEAHRRVAANQALLVCAYEDDARCRMLNLDGSMSLT |
| Ga0126384_123330012 | 3300010046 | Tropical Forest Soil | MADTADIERISVKQAREKAHQALLVCAYENEAKHRILNLDGSISLANFRSRLASLPK |
| Ga0099796_103097752 | 3300010159 | Vadose Zone Soil | MADIERINAQQTHTQAESNRALLVCAYEDEAKCRMLNLDG |
| Ga0137393_103639311 | 3300011271 | Vadose Zone Soil | MADIERISAQQSHTKAKSNQALLVCAYEDEAKCRMLNLDGSISF |
| Ga0137389_110890322 | 3300012096 | Vadose Zone Soil | MQRPTDIGRGGDMADIQRISVQQAHAKTKANQALLVCAYEDEAKCRMLNL |
| Ga0137364_102976851 | 3300012198 | Vadose Zone Soil | VVDIERISAQQAHAKIKANQALLVCAYEDEAKCNMFNLEGSISFTS |
| Ga0137383_110349482 | 3300012199 | Vadose Zone Soil | MADIKRISVQQAYAKTKANQALLVCAYEDEAKCRMLNLDGSIS |
| Ga0137363_106458543 | 3300012202 | Vadose Zone Soil | MADIKRISVQQAYAKTKANQALLVCAYEDEAKCRML |
| Ga0137399_100622071 | 3300012203 | Vadose Zone Soil | MADIKRISVQQAYAKTKANQALLVCAYEDEAKCRM |
| Ga0137399_101678993 | 3300012203 | Vadose Zone Soil | MTDIERISVQQARAKTKANQVLLVCAYEDEAKCRMLNLDGSI |
| Ga0137362_103066281 | 3300012205 | Vadose Zone Soil | MADIERISAQQAHTNAKSNQALLVCAYEDEAKCRMLN |
| Ga0137362_109748361 | 3300012205 | Vadose Zone Soil | MADIQRISAQEAHAKTKANQALLVCAYEDEAKCRMLNL |
| Ga0137377_119196051 | 3300012211 | Vadose Zone Soil | MAQGGQMAEIKRISVQQAYAKTNANQALLVCAYEDEAKCRMLN |
| Ga0137360_101484105 | 3300012361 | Vadose Zone Soil | MADVERISVQQAHAKTNAKQALLVCAYEDEAKCRMFNLEGSISFTKF |
| Ga0137361_103461761 | 3300012362 | Vadose Zone Soil | MAQGGQMADIKRISVQQAYAKTKANQALLVCAYEDE |
| Ga0137358_107993081 | 3300012582 | Vadose Zone Soil | MADIERISVQQAQAKTKANQALLVCAYEDEAKCRMLNLEGSIS |
| Ga0137398_107763392 | 3300012683 | Vadose Zone Soil | MADIERIGAQQAHTKAKSNQALLVCAYEDEAKCRML |
| Ga0137397_111532272 | 3300012685 | Vadose Zone Soil | MADIERISVQQAHTKSKSNQALLVCAYEDEAKCRMLNLDDSISFTSF |
| Ga0137395_110635111 | 3300012917 | Vadose Zone Soil | MADIERISAQQAHAKTKANQALLVCAYEDEAKCRMLNLDGSISFA |
| Ga0137395_110864761 | 3300012917 | Vadose Zone Soil | MADIQRISAQQAHAKSKANQALLVCAYEDEAKCRMLNLDGSISFAS |
| Ga0137396_105221123 | 3300012918 | Vadose Zone Soil | MADIERISAQQAHTKATSKQALLVCGYEDEAKCRMFNLDGSISFTSF |
| Ga0137394_111183731 | 3300012922 | Vadose Zone Soil | MADIERISVQEAHPKTNANQALLVCAYEDEAKCRM |
| Ga0137394_111423831 | 3300012922 | Vadose Zone Soil | MADIERISVQEAHRKTKATQALLVCAYEDEAKCRMLN |
| Ga0137359_117825712 | 3300012923 | Vadose Zone Soil | MADIKRISVQQAHAKTKANQALLVCAYEDEAKCRMLNLDGSISFAAL |
| Ga0137416_100791961 | 3300012927 | Vadose Zone Soil | MAQGGQMADIKRISVQQAYAKTKANQALLVCAYEDEAKCRM |
| Ga0137404_108886481 | 3300012929 | Vadose Zone Soil | MADIERISVEEAHRKLKENQALLVCAYEDEAKCRMLDL |
| Ga0137410_117583621 | 3300012944 | Vadose Zone Soil | MADIERISVQQAHTKSKSNQALLVCAYEDEAKCRMLNLDGSIS |
| Ga0164303_102246053 | 3300012957 | Soil | MADMADIERISVKQARGKAHQALLVCAYENEAKHRMFNLDGTISLADFQ |
| Ga0157375_108100363 | 3300013308 | Miscanthus Rhizosphere | MADMADIERISVKQARGKAHQALLVCAYENEAKHR |
| Ga0134078_102979131 | 3300014157 | Grasslands Soil | MAQGGQMADVKRISVQQAYAKTNANQALLVCAYEDEAKCRMLNLDGSISF |
| Ga0137412_105613182 | 3300015242 | Vadose Zone Soil | MADIERISAQQANTKAKSNQALLVCAYEDEAKCRMLN |
| Ga0182005_12620242 | 3300015265 | Rhizosphere | MDVQRISVGDARRKVQAKQALLVCAYEDAAKCRMVNLE |
| Ga0132257_1045107391 | 3300015373 | Arabidopsis Rhizosphere | MADIERIGVIQARGKAHQALLVCAYENEAKHRMFNLDGSISLANFRS |
| Ga0182037_1000415410 | 3300016404 | Soil | MVDIERISVKQAREKAHQALLVCAYENEAKQRMFNLDGSISLA |
| Ga0066667_121318541 | 3300018433 | Grasslands Soil | VPEITRIPVEEAHQKTSAGQALLVCAYDDEAKCRTFNLKG |
| Ga0182025_11550162 | 3300019786 | Permafrost | MADIKRISVQQAHAKTKANQALLVCAYEDEAKCRMLNLDGSISFA |
| Ga0179592_105317371 | 3300020199 | Vadose Zone Soil | MADIERISAQQAHTKAESNQALLVCAYEDEAKCRMLNLDGSI |
| Ga0210399_100607531 | 3300020581 | Soil | MADIQRITVQQAYAKTKANQALLVCAYEDEAKCRKLSLDGSISFASL |
| Ga0210404_104661673 | 3300021088 | Soil | MADIERISVQQAHAKANQALLVCAYEDEAKCRMLNLDGSIS |
| Ga0210406_103420452 | 3300021168 | Soil | MADIQRISVQEAHAKTKAKQALLVCAYEDEAKCRK |
| Ga0210406_110046462 | 3300021168 | Soil | MADIKRISVQQAHAKTKANQALLVCAYEDEAKCRM |
| Ga0210405_100963543 | 3300021171 | Soil | MADIKRISVQQAHAKTNAKQALLVCAYEDEAKCRMFNLEGSLSFTKF |
| Ga0210408_111471721 | 3300021178 | Soil | MADIKRISVQQAHAKTNAKQALLVCAYEDEAKCRMFNLEGSISFTK |
| Ga0210393_101141664 | 3300021401 | Soil | MAEVERISVEQAYRRVKEHQALLVCAYEDEAKCRML |
| Ga0210391_103390551 | 3300021433 | Soil | MADIKRISVQQAHAKTKAKQALLVCAYEDEAKCQRLNLDGSISF |
| Ga0210398_103403493 | 3300021477 | Soil | MADIKRIGVQQAYAKTKANQALLVCAYEDEAKCRMLNLDGSISF |
| Ga0210402_103966653 | 3300021478 | Soil | MADIQRISVQQAHAKTKANQALLVCAYEDEAKCRMLNLDGS |
| Ga0210409_104920231 | 3300021559 | Soil | MADVERIGVEQAHAKANQALLVCAYEDEAKCRVFNLAGSISLAN |
| Ga0222622_102931411 | 3300022756 | Groundwater Sediment | MADIERISVEDAHKKLKENQALLVCAYEDEAKCRMLNLDGS |
| Ga0207684_104990011 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MADIKRISVQQAYAKTKANQALLVCAYEDEAKCRMLNLDGSISFAS |
| Ga0207712_119511021 | 3300025961 | Switchgrass Rhizosphere | MPDIERISVEDAHRKVGANQALLVCAYEDEAKCRAVNL |
| Ga0207703_113826481 | 3300026035 | Switchgrass Rhizosphere | MADIERIGVKQAHEKVHQALLVCAYENEAKHRMFNLDDSIS |
| Ga0207675_1005953821 | 3300026118 | Switchgrass Rhizosphere | MPDIERISVEEAHRKVGANQALLVCAYEDEAKCRAVNL |
| Ga0209131_12616492 | 3300026320 | Grasslands Soil | MADIQRISAQEAHAKTKANQALLVCAYEDEAKCRMLNLDGSI |
| Ga0209803_12260351 | 3300026332 | Soil | MANMADIERIGVKQARGKAHQALLVCAYESEAKHRMFNLDGSISLANFRS |
| Ga0179587_100984753 | 3300026557 | Vadose Zone Soil | MADIKRISVQQAYAKTKANQALLVCAYEDEAKCRMLN |
| Ga0209422_11512542 | 3300027629 | Forest Soil | MADIERINAQQAHTKAKSNQALLVCAYEDEAKCRMLNL |
| Ga0209799_10101793 | 3300027654 | Tropical Forest Soil | MVDMADIERISVKQAREKAHQALLVCAYENEAKHRMSTSSIS |
| Ga0209736_10345471 | 3300027660 | Forest Soil | VADIQRISVQEAHAKTKANQALLVCAYEDEAKCRMLNLDGSI |
| Ga0209328_100929651 | 3300027727 | Forest Soil | MADIQRISAQQAHAKSKANQALLVCAYEDEAKCRMLNLDGSIS |
| Ga0209380_107660472 | 3300027889 | Soil | MAEIQRISVQQAHAKTKANQALLVCAYEDEAKCQRLSLDGSIS |
| Ga0209624_104476682 | 3300027895 | Forest Soil | MADIKRIGVQQAYAKTKANQALLVCAYEDEAKCRMLNLD |
| Ga0268265_102709281 | 3300028380 | Switchgrass Rhizosphere | MAEIERISAEETHRKVDANQALLVCAYEDDAKCRMV |
| Ga0308309_104506691 | 3300028906 | Soil | MADIQGIDAQQTHTKAKSNQALLVCAYEDEAKCRRLNLDGSISFANFKSR |
| Ga0170834_1004669921 | 3300031057 | Forest Soil | MADIKRISVQQAHAKTKANQALLVCAYEDEAKCRMLNL |
| Ga0170823_120876321 | 3300031128 | Forest Soil | MAEVERISVEQAYRRVKEHQGLLVCAYEDEAKCRMLNLDGSI |
| Ga0310686_1002567813 | 3300031708 | Soil | MADIQRISVQQAHAKTKANQALLVCAYEDEAKCRMLNLDG |
| Ga0310686_1140088471 | 3300031708 | Soil | MADIKRISVQQAHAKTKANQALLVCAYEDEAKCRMLNLDG |
| Ga0307477_102796402 | 3300031753 | Hardwood Forest Soil | MADIERISAEKAHERADQALLVCAYEDEAKYRLCRVTGKVRS |
| Ga0310916_116486572 | 3300031942 | Soil | MADIERISVKQAREKAHQALLVCAYDNEAKYRIANLEDSISLADFRSR |
| Ga0318530_102003181 | 3300031959 | Soil | MADIERISVKQAREKANQALLVCAYDNEAKYRIVNLEGSISLAH |
| Ga0307479_102356013 | 3300031962 | Hardwood Forest Soil | MADIHRISAQQAHAKSKANQALLVCAYEDEAKCRMLNLDGSISFASL |
| Ga0307479_102920205 | 3300031962 | Hardwood Forest Soil | MADIKRISVQQAYAKTKANQALLVCAYEDEAKCRMLNLD |
| Ga0307479_104314792 | 3300031962 | Hardwood Forest Soil | MAQGGQMADIKRISVQQAYAKTKTKTKTKTKTNQALLVCAYEDEEK |
| Ga0310890_107961681 | 3300032075 | Soil | MAEIERISAEETHRKVDANQALLVCAYEDDAKCRMVNLE |
| Ga0307471_1029423942 | 3300032180 | Hardwood Forest Soil | MADVKRISVQQAYAKTKANQALLVCAYEDEAKCRM |
| Ga0307472_1001004803 | 3300032205 | Hardwood Forest Soil | MADIHRISAQQAHAKSKANQALLVCAYEDEAKCRMLNLERSISFAS |
| ⦗Top⦘ |