


| Basic Information | |
|---|---|
| Family ID | F097898 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MIWVGSFKSLQSALDKPRFGAALEVHTWLRSEIGLISPFVDWLM |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.04 % |
| % of genes near scaffold ends (potentially truncated) | 90.38 % |
| % of genes from short scaffolds (< 2000 bps) | 86.54 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.115 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (36.538 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.731 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.154 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.06% β-sheet: 0.00% Coil/Unstructured: 81.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF07690 | MFS_1 | 19.23 |
| PF07883 | Cupin_2 | 12.50 |
| PF13561 | adh_short_C2 | 6.73 |
| PF01370 | Epimerase | 3.85 |
| PF00440 | TetR_N | 2.88 |
| PF16884 | ADH_N_2 | 1.92 |
| PF00106 | adh_short | 0.96 |
| PF04248 | NTP_transf_9 | 0.96 |
| PF05368 | NmrA | 0.96 |
| PF12680 | SnoaL_2 | 0.96 |
| PF13581 | HATPase_c_2 | 0.96 |
| PF11453 | DUF2950 | 0.96 |
| PF08448 | PAS_4 | 0.96 |
| PF00296 | Bac_luciferase | 0.96 |
| PF13340 | DUF4096 | 0.96 |
| PF12697 | Abhydrolase_6 | 0.96 |
| PF03928 | HbpS-like | 0.96 |
| PF00126 | HTH_1 | 0.96 |
| PF03061 | 4HBT | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.96 |
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.12 % |
| Unclassified | root | N/A | 2.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002561|JGI25384J37096_10030280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2110 | Open in IMG/M |
| 3300002914|JGI25617J43924_10041922 | All Organisms → cellular organisms → Bacteria | 1653 | Open in IMG/M |
| 3300002914|JGI25617J43924_10047997 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300002914|JGI25617J43924_10102738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1021 | Open in IMG/M |
| 3300002914|JGI25617J43924_10327892 | Not Available | 529 | Open in IMG/M |
| 3300002917|JGI25616J43925_10149597 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300002917|JGI25616J43925_10240330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 683 | Open in IMG/M |
| 3300004633|Ga0066395_10249226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 951 | Open in IMG/M |
| 3300005332|Ga0066388_104618696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300005439|Ga0070711_101025382 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005439|Ga0070711_101742372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300005555|Ga0066692_10628765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 671 | Open in IMG/M |
| 3300005557|Ga0066704_10652543 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005921|Ga0070766_10199343 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
| 3300006173|Ga0070716_100888871 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300006173|Ga0070716_101147827 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300006806|Ga0079220_10474349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300006871|Ga0075434_100620393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1100 | Open in IMG/M |
| 3300007255|Ga0099791_10164619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1040 | Open in IMG/M |
| 3300007255|Ga0099791_10216014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
| 3300007255|Ga0099791_10408093 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300007265|Ga0099794_10115305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1348 | Open in IMG/M |
| 3300007265|Ga0099794_10224986 | Not Available | 964 | Open in IMG/M |
| 3300007265|Ga0099794_10723711 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300009038|Ga0099829_11547237 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300009038|Ga0099829_11563603 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300009089|Ga0099828_10120149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2295 | Open in IMG/M |
| 3300010046|Ga0126384_10675467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
| 3300010322|Ga0134084_10151067 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300010360|Ga0126372_11816335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300011120|Ga0150983_15851825 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300011269|Ga0137392_10027813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 4062 | Open in IMG/M |
| 3300011269|Ga0137392_10136083 | All Organisms → cellular organisms → Bacteria | 1973 | Open in IMG/M |
| 3300011269|Ga0137392_10334895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1253 | Open in IMG/M |
| 3300012096|Ga0137389_10149712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1909 | Open in IMG/M |
| 3300012189|Ga0137388_11060424 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300012203|Ga0137399_10599962 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300012203|Ga0137399_11685301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus | 522 | Open in IMG/M |
| 3300012205|Ga0137362_10051288 | All Organisms → cellular organisms → Bacteria | 3365 | Open in IMG/M |
| 3300012361|Ga0137360_10155872 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
| 3300012362|Ga0137361_10056324 | All Organisms → cellular organisms → Bacteria | 3266 | Open in IMG/M |
| 3300012582|Ga0137358_10648679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300012917|Ga0137395_11177824 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300012918|Ga0137396_10044125 | All Organisms → cellular organisms → Bacteria | 3028 | Open in IMG/M |
| 3300012922|Ga0137394_10948358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300012923|Ga0137359_10793446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300012927|Ga0137416_10140542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 1876 | Open in IMG/M |
| 3300012927|Ga0137416_10385873 | Not Available | 1183 | Open in IMG/M |
| 3300012927|Ga0137416_11138875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300012930|Ga0137407_10533855 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300012944|Ga0137410_10279783 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300012957|Ga0164303_10079170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1562 | Open in IMG/M |
| 3300015052|Ga0137411_1004382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300015053|Ga0137405_1378243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6332 | Open in IMG/M |
| 3300015054|Ga0137420_1441728 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300015245|Ga0137409_10689833 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300016270|Ga0182036_11431451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300019789|Ga0137408_1082727 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
| 3300020170|Ga0179594_10068753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1230 | Open in IMG/M |
| 3300020579|Ga0210407_10185369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1614 | Open in IMG/M |
| 3300020579|Ga0210407_10246318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1392 | Open in IMG/M |
| 3300020583|Ga0210401_10567678 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300021046|Ga0215015_10761954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300021171|Ga0210405_10912034 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300021178|Ga0210408_10405611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
| 3300021180|Ga0210396_11320697 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300021401|Ga0210393_11630101 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300021406|Ga0210386_11186407 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300021474|Ga0210390_10559709 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300021475|Ga0210392_11105168 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300021478|Ga0210402_10019603 | All Organisms → cellular organisms → Bacteria | 5800 | Open in IMG/M |
| 3300021479|Ga0210410_10000908 | All Organisms → cellular organisms → Bacteria | 29079 | Open in IMG/M |
| 3300021559|Ga0210409_10798608 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300024330|Ga0137417_1274438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2028 | Open in IMG/M |
| 3300025906|Ga0207699_10293883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 1133 | Open in IMG/M |
| 3300025910|Ga0207684_10711404 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300026320|Ga0209131_1323418 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300026322|Ga0209687_1162455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300026377|Ga0257171_1012045 | All Organisms → cellular organisms → Bacteria | 1423 | Open in IMG/M |
| 3300026446|Ga0257178_1013362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 932 | Open in IMG/M |
| 3300026508|Ga0257161_1096623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300026515|Ga0257158_1010735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1406 | Open in IMG/M |
| 3300026532|Ga0209160_1126519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1242 | Open in IMG/M |
| 3300027297|Ga0208241_1070446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300027548|Ga0209523_1105764 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300027698|Ga0209446_1001205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6079 | Open in IMG/M |
| 3300027698|Ga0209446_1117251 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300027768|Ga0209772_10062693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1116 | Open in IMG/M |
| 3300027846|Ga0209180_10086760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1772 | Open in IMG/M |
| 3300027846|Ga0209180_10486640 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300027879|Ga0209169_10116067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1388 | Open in IMG/M |
| 3300028047|Ga0209526_10668860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300031231|Ga0170824_113978177 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300031231|Ga0170824_116084980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 557 | Open in IMG/M |
| 3300031708|Ga0310686_106229738 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300031715|Ga0307476_10436764 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300031753|Ga0307477_10043831 | All Organisms → cellular organisms → Bacteria | 3073 | Open in IMG/M |
| 3300031754|Ga0307475_10040220 | All Organisms → cellular organisms → Bacteria | 3458 | Open in IMG/M |
| 3300031754|Ga0307475_10161391 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
| 3300031754|Ga0307475_10496138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 980 | Open in IMG/M |
| 3300031823|Ga0307478_10722694 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300032174|Ga0307470_11301230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300032180|Ga0307471_100552163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1306 | Open in IMG/M |
| 3300032180|Ga0307471_103798141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 36.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.35% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25384J37096_100302801 | 3300002561 | Grasslands Soil | MIWVGSFKPLQSALAKLDFTGAPLEVHTWVQSEIGLISPLVD |
| JGI25617J43924_100419221 | 3300002914 | Grasslands Soil | MIWVGSFKSLQSALDKPRFAVPLEVHTWLPSDIGLISPFVDWLISLIAESRCVR |
| JGI25617J43924_100479971 | 3300002914 | Grasslands Soil | MLWVGNFKSLQSVLDKPSSGAPLEVHTWLRSETGLISPLVDWLVSLVARSGCVPG |
| JGI25617J43924_101027382 | 3300002914 | Grasslands Soil | MIWVGSFKSLQSILSKPRFSGAPLEVHTWVRSEIALISPLVAWL |
| JGI25617J43924_103278921 | 3300002914 | Grasslands Soil | MIWVGSFKSLRSALRERRFITAPLEVHTWLRSEIGLISPLVDWLTSLIAG |
| JGI25616J43925_101495971 | 3300002917 | Grasslands Soil | MIWVGSFKSLQSALDKPRFAVPLEVHTWLPSDIGLISPFVDWLISLIAES |
| JGI25616J43925_102403301 | 3300002917 | Grasslands Soil | MTWVGSFKSLQSVLRKPRFTGAPLQVHTWVRSEIGLISPLVDWLMSLMVGSC |
| Ga0066395_102492261 | 3300004633 | Tropical Forest Soil | VICVGSFKSLESLRDKPRLTGAPFEVRTWVGSDTRLISPLVDWLMNLVAES |
| Ga0066388_1046186961 | 3300005332 | Tropical Forest Soil | MIWVGSLRSLQDVIPKLRFTDAPVEVHTWLRSEIGLISPLVDWLMSLIAG |
| Ga0070711_1010253821 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWVGSFQSLQSVLTKPRFSGEPLVHTWLRSEIGLLSPFV |
| Ga0070711_1017423721 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKWASEMIWVGCFKSLQSVLPEPRSTDAPLAVHTWVRTEIGLITPLVDWLMSLIVGS |
| Ga0066692_106287652 | 3300005555 | Soil | MIWVGSFKSLQTVLGKPRFTGAPLDVHTWVRSEIALISPLVDWLMNLIAT |
| Ga0066704_106525431 | 3300005557 | Soil | MIWVGSFKSLHSALRKPRFTAAPLEVHTWLRSDIGLISPFVDWLISLIAESRCV |
| Ga0070766_101993431 | 3300005921 | Soil | MIWVGNFKSLQSVLDKPRSGAPLEVHTWLRSETGLISPFADWLMSLIVRSGCVPGKE |
| Ga0070716_1008888711 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWVGSFKSLRSALHKPRFGAPLEVHTWLRSDIGLIS |
| Ga0070716_1011478272 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWIGSFKSLQSALHKPRLGAALEVHTWLRSEIGLISPFVDKTLQPG* |
| Ga0079220_104743491 | 3300006806 | Agricultural Soil | MIWVGSFKSLQTVLDKHRFTRAPLDVHTWVRNEIALISPLVDWLMNLIATSHCV |
| Ga0075434_1006203932 | 3300006871 | Populus Rhizosphere | MVWVGSFKSLQTVLGKHRFTGAPLDVHTWVRSEIVLISPLVDWLMNLIATSHCV |
| Ga0099791_101646192 | 3300007255 | Vadose Zone Soil | MIWVGSFKSLQLKLPKLRLTDAPLEVHTWVQSEIGQISPL |
| Ga0099791_102160141 | 3300007255 | Vadose Zone Soil | MIWVGSFKSLQTVLGKHRFTGAPLDVHTWVRSEIALISPLVDW |
| Ga0099791_104080932 | 3300007255 | Vadose Zone Soil | MIRVGNFKSPQSALDKPPGGAPLEVQTWLRSETSQISPFADWLMSLIARSGC |
| Ga0099794_101153051 | 3300007265 | Vadose Zone Soil | MIWVGSFKSLQSALDKPRFAVPLEVHTWLPSDIGLISPFVDWLISLIAESRC |
| Ga0099794_102249862 | 3300007265 | Vadose Zone Soil | MIWVGSFKSLQAVLGKPRFTGTPLDVHTWVRSEVALIS |
| Ga0099794_107237111 | 3300007265 | Vadose Zone Soil | MIWVGSFKSLQSALDKPRFAVPLKVHTWLPSDIGLISPFVDWLISLIAESR |
| Ga0099829_115472371 | 3300009038 | Vadose Zone Soil | MIWVGGFQSLQAALRKPRFTGDSLEVHTWLRSEIALISP |
| Ga0099829_115636032 | 3300009038 | Vadose Zone Soil | MIWVGSFKSLQSALHKPRLSAPLEVHTWLRSEIVLISPFVDWL |
| Ga0099828_101201491 | 3300009089 | Vadose Zone Soil | MIWVGSFQSLQTVLGKPRFTGAPLDVHTWVRSEIALISPLVDWLMNLIATS |
| Ga0126384_106754671 | 3300010046 | Tropical Forest Soil | MTWVGNFKSLQTVHGKHRFTGAPLDVHTWVRSEIALISPLVDWL |
| Ga0134084_101510671 | 3300010322 | Grasslands Soil | MIWVGNFKSLQTVLGKPRFTGAPLDVHTWVRTEIALISPLVDWLMNLIATSHCVC |
| Ga0126372_118163352 | 3300010360 | Tropical Forest Soil | VICVGSFKSLESLLDKSRFTGAPFEVRTWVGSDTRLISPLVDW |
| Ga0150983_158518252 | 3300011120 | Forest Soil | MIWVGSFKSLQSALDKPRFGAPLEVHTWLRSEIGLISPFVSAHERVPR* |
| Ga0137392_100278134 | 3300011269 | Vadose Zone Soil | MTWVGSFRSLESVVRKADFTNAPLELHTWVRSESGLISP |
| Ga0137392_101360831 | 3300011269 | Vadose Zone Soil | MIWVGSFKSLQSALDKPRFGAALEVHTWLRSEIGLISPFVDWLM |
| Ga0137392_103348951 | 3300011269 | Vadose Zone Soil | MIWVGSFKSLQSMLPKLRFTDALLEVHTWVQSEIGQ |
| Ga0137389_101497121 | 3300012096 | Vadose Zone Soil | MTWVGSFKSLRSVLPEPSFCAPLGVHTWLESEIDLISPFVDWL |
| Ga0137388_110604241 | 3300012189 | Vadose Zone Soil | MIWVGSFKSLQSALDKPRFGAALEVHTWLRSEIGLISP |
| Ga0137399_105999623 | 3300012203 | Vadose Zone Soil | MIWVGNFKSLQSALDKPPSGAPLEVHTWLRSEIDLISPFVDWLISLIARS |
| Ga0137399_116853011 | 3300012203 | Vadose Zone Soil | MIWVGSFKSLRSVLHKRRFITAPLKVHTWVGSEIGLISPL |
| Ga0137362_100512885 | 3300012205 | Vadose Zone Soil | MIWVGSFKSLQPALREPRLPGAPLEVHTWLRSEIGLISP |
| Ga0137360_101558724 | 3300012361 | Vadose Zone Soil | MIWVGNFKSLQLVLHKPRFGAPLEVHTWLRSETGLISPFA |
| Ga0137361_100563245 | 3300012362 | Vadose Zone Soil | MIWVGSFKSLQSMLPKLRFTDAPLEVHTWVQSEIGQISPLVDWLI |
| Ga0137358_106486791 | 3300012582 | Vadose Zone Soil | MTWVGSFKSLQPVLSKIDLTDAPLELHSWVRSEIGLISPLVDWLMSLI |
| Ga0137395_111778242 | 3300012917 | Vadose Zone Soil | MIWVGSFESLRSALPKPRFGAPLEVHTWLPSDIGLISPFVDWLISLIAESRCVRGKE |
| Ga0137396_100441251 | 3300012918 | Vadose Zone Soil | MTWVGSFKSLQSVLGKFDFTDAPLELHSWVRSEIGLISPL |
| Ga0137394_109483581 | 3300012922 | Vadose Zone Soil | MIWVGSFKSLQSMLPKLRFTDAPLEVHTWVQSEIGQISPLVDWL |
| Ga0137359_107934461 | 3300012923 | Vadose Zone Soil | MIWVGSFKPLQSALAKLDFTDAPLEVDTWVRSEIGLISPL |
| Ga0137416_101405421 | 3300012927 | Vadose Zone Soil | MLWVGNFKSLQSVLDKPSSGGPLEVHTWLRSETGLISPLVDWLMSLVARSGCV |
| Ga0137416_103858731 | 3300012927 | Vadose Zone Soil | MIWVGSFKSLQTVLGKPRFTGAPLDVHTWVRSEIALISPLV |
| Ga0137416_111388751 | 3300012927 | Vadose Zone Soil | MSWVGSFKSLQSMPPELRFTDAPLEVHTWMPSEIGLISPLVDWLM |
| Ga0137407_105338551 | 3300012930 | Vadose Zone Soil | MIWVGSFKSLQSALGKFDFTDAPLELHTWVRSEIGLISPLVDW |
| Ga0137410_102797831 | 3300012944 | Vadose Zone Soil | MIWVGNFKSLQSALDKPSSGAPLEVHTWLRSETGLISPLVDWLMSLVARSGCV |
| Ga0164303_100791702 | 3300012957 | Soil | MIWIGSFKPLQSALARLDFTDAPLEVDTWVRSEIGLISPLVDWLMSLIAV |
| Ga0137411_10043822 | 3300015052 | Vadose Zone Soil | MIWVGSFKSLQSMLPKLRFTDAPLEVHTWVQSEIGQI |
| Ga0137405_137824310 | 3300015053 | Vadose Zone Soil | LVGSFKSLQSMLPKLRFTDAPLEVHTWVQSEIGQISPLVDGL* |
| Ga0137420_14417283 | 3300015054 | Vadose Zone Soil | MIWVGSFKSLQSARHKPRFGAPLEVHTWLRSETGLISP |
| Ga0137409_106898334 | 3300015245 | Vadose Zone Soil | MIRVGNFKSPQSALDKPPAGAPLEVQTLLRSETSQISPFADWLMSL |
| Ga0182036_114314512 | 3300016270 | Soil | KEGAKMVWVGSFKSLQAVLSRPRLMNAPIEVHTRVPTNIGLISPLVD |
| Ga0137408_10827274 | 3300019789 | Vadose Zone Soil | MIWVGSFNSLQSALHRPPFGTALEVHTWLRSETGLISPFADWLMSVVARSGC |
| Ga0179594_100687531 | 3300020170 | Vadose Zone Soil | MIWVGSFKSLQLALRKPRFPGAPLEVHTWLRSEIGLI |
| Ga0210407_101853691 | 3300020579 | Soil | MIWVGSFKSLQLILPEIRFADAPLEVRTWVRSEIGLLSPLVEWLMSLIVAS |
| Ga0210407_102463181 | 3300020579 | Soil | MIWVGSFKSLQSALDKPRFGAPLEVHTWLRSEIGLISPFVSAHERVPR |
| Ga0210401_105676784 | 3300020583 | Soil | MIWVGSFKSLRSALHKPRFGAPLEVLTWLRSDIGL |
| Ga0215015_107619542 | 3300021046 | Soil | MIWVGSFKSLQSRLPELRSADAPLEVHTWVHSEIGLISPLVEGL |
| Ga0210405_109120342 | 3300021171 | Soil | MIWVGSFQSLRSAPRKPRFRAPLKVHTWLRSEIDL |
| Ga0210408_104056111 | 3300021178 | Soil | MIWVGSFKSLRSALHKPRFGAPLEVHTWLRSDIGLISPFVDWLMSLVAR |
| Ga0210396_113206971 | 3300021180 | Soil | MIWVGNFKSLHSVLNKPRFTEDSLEVHTWLRSEIALIS |
| Ga0210393_116301012 | 3300021401 | Soil | MIWVGSFKSLQSALDKPRFAVPLEVHTWLPSDIGL |
| Ga0210386_111864072 | 3300021406 | Soil | MIWVGSFKSLQSALDKPRLGAPLEVHTWLRSETGLISPFVDWLMSLIARSGCV |
| Ga0210390_105597093 | 3300021474 | Soil | MIWVGSFQSLRSAPRKPRFRAPLKVHTWLRSEIDLISPF |
| Ga0210392_111051681 | 3300021475 | Soil | MVWVGNFKSLQSALDKPSSGAPLEVHTWLRSEIGLIS |
| Ga0210402_100196036 | 3300021478 | Soil | MIWVGSFKSLQKALGKPRFTDAPLQVHTWLRSEIALISPFTGWLMRVIAGYRGL |
| Ga0210410_1000090822 | 3300021479 | Soil | MIWVGSFKSLQSVLPEPRSTDAPLAVHTWVRSEIGLITPLVDWLMSLIAGETPISTFPF |
| Ga0210409_107986083 | 3300021559 | Soil | MLWVGDFKSLQSALEKPRSGAPLGVHTWLRSETDLISPLA |
| Ga0137417_12744381 | 3300024330 | Vadose Zone Soil | MIWVGSFKSLRSALRERRFITAPLEVHTWLRRSEIG |
| Ga0207699_102938834 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MIWIGSFKSLQSALHKPRLGAALEVHTWLRSEIGLISPFVDKTLQPG |
| Ga0207684_107114041 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVWVGSFKSLQSALHRPRFRGAPLEVHTWVGTDIGLISSLVDWLMSLIAA |
| Ga0209131_13234182 | 3300026320 | Grasslands Soil | MIWVGSFKSLQSAVHRPPFGAALEVHTWLHSETGLIS |
| Ga0209687_11624551 | 3300026322 | Soil | VICIGSFKSLESLLDKPQFTGAPFEVRTWVGSDTRLISPLVDWLMNL |
| Ga0257171_10120453 | 3300026377 | Soil | MIWVGSFKSLQSALDKPRFAVPLEVHTWLPSDIGLISPFVDWLISLI |
| Ga0257178_10133621 | 3300026446 | Soil | MIWVGSFKSLQSALDKPRFAVPLEVHTWLPSDIGLISPFVD |
| Ga0257161_10966231 | 3300026508 | Soil | MIWVGSFKSLRSALHKRRFITAPLKVHTWVGSEIGLISPLVDWLMSLIARSRCV |
| Ga0257158_10107351 | 3300026515 | Soil | MVWVGNFKSLQSALDKPSSGAPLEVHTWLRSEIGLI |
| Ga0209160_11265191 | 3300026532 | Soil | MIWVGSFKSLHSALRKPRFTAAPLEVHTWLRSDIGLISPFVDWLISLIAESRC |
| Ga0208241_10704462 | 3300027297 | Forest Soil | MIWVGSFKSLQLVLPEPRSTDAPLAVHTWVRSEIGLITPLVDWLMSLIAGETPISTFPF |
| Ga0209523_11057641 | 3300027548 | Forest Soil | MIWVGSFKSLRSALHKPRFGAPLEVHTWLRSDIGLISPFVD |
| Ga0209446_10012051 | 3300027698 | Bog Forest Soil | MTWVGSFKSLQAVLPEPSFGAPLKVHTWLRSEIDLISP |
| Ga0209446_11172512 | 3300027698 | Bog Forest Soil | MTWVGSFKSLQAVLPEPSFGAPLKVHTWLRSEIDLISPFVDWLMSLIDQSRCVDG |
| Ga0209772_100626931 | 3300027768 | Bog Forest Soil | MVWVGNFKSLQSALDKPSSGAPLEVHTWLRSEIGLISPFVDWLMSLIA |
| Ga0209180_100867603 | 3300027846 | Vadose Zone Soil | MIWVGSFQSLQSALPKPRFTGDPLEVHTWLRSEIALISPFVDWLMSLR |
| Ga0209180_104866402 | 3300027846 | Vadose Zone Soil | MIWVGSFKSLQSALDKPRFAAPLEVHTWLPSDIGLISP |
| Ga0209169_101160673 | 3300027879 | Soil | MVWVGNFKSLQSALDKPSSGAPLEVHTWLRSEIGLISPFVDWLMS |
| Ga0209526_106688602 | 3300028047 | Forest Soil | MSWLGSFKSLQTVLGKHRFTSAPLDVHTWVRSEIALISPLVDWLMSL |
| Ga0170824_1139781771 | 3300031231 | Forest Soil | MLWVGNFKSLQSALDKPSFDAPLEVHTWVRSEIGLISPLVGWLMSL |
| Ga0170824_1160849802 | 3300031231 | Forest Soil | MIGVGSFKSLHTVLDKHRFTGAPLYVQTWVRSEIALISPPVDWLTNLVAS |
| Ga0310686_1062297381 | 3300031708 | Soil | MIWVGSFKSLQSALHKPSVGAPLEVHTWLRSEIVLISPFVDWLMSLIARSRCVG |
| Ga0307476_104367644 | 3300031715 | Hardwood Forest Soil | MIWVGSFKSLRSALHKPRFGAPLEVHTWLRSDIGLISPFVDWLMSLVARTGCVP |
| Ga0307477_100438314 | 3300031753 | Hardwood Forest Soil | MTWVGSFKSLQSVLRRPRFTGAPLEVRTWVRSEIALISPLVDWLMTLIAA |
| Ga0307475_100402205 | 3300031754 | Hardwood Forest Soil | MIWVGSFKSLRSALREPRFPGAPLVVHTWLRSEIGLISPLVDWLMSLITASR |
| Ga0307475_101613913 | 3300031754 | Hardwood Forest Soil | MIWVGNFKSLQSALDKPPSGAPLEVHTWLRSEIDLISPFVDWLISLIARSACVPG |
| Ga0307475_104961381 | 3300031754 | Hardwood Forest Soil | MIWVGSFNSLRSALHKRRFLNAPLKVHTWAPSEIGLI |
| Ga0307478_107226941 | 3300031823 | Hardwood Forest Soil | MIWVGSFKSLQAVLPKRGFIRAPLGVHTWLRSEIRLI |
| Ga0307470_113012302 | 3300032174 | Hardwood Forest Soil | MIWIGSFKPLQSALARLDFTDAPLEVDTWVRSEIGLISPLGDWLMSLIAVS |
| Ga0307471_1005521631 | 3300032180 | Hardwood Forest Soil | MIWVGSFKSLQSALGKFDFTDVPLELHTWVRSEIGLISPLVDWLMSLIAGSRCVF |
| Ga0307471_1037981411 | 3300032180 | Hardwood Forest Soil | MIWVGSFKSLQSRLPKLPFTDAPLEVRTWVQSEIGQISPLVDWLMNLIAAS |
| ⦗Top⦘ |