


| Basic Information | |
|---|---|
| Family ID | F097874 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 38 residues |
| Representative Sequence | VRRLGPSAVGAINKIFGFLILAIAVQLVWDGVADFKN |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.81 % |
| % of genes near scaffold ends (potentially truncated) | 95.19 % |
| % of genes from short scaffolds (< 2000 bps) | 86.54 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.154 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.462 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.962 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.962 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.15% β-sheet: 0.00% Coil/Unstructured: 53.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF01964 | ThiC_Rad_SAM | 25.00 |
| PF01914 | MarC | 7.69 |
| PF13185 | GAF_2 | 6.73 |
| PF13649 | Methyltransf_25 | 2.88 |
| PF01734 | Patatin | 1.92 |
| PF07681 | DoxX | 1.92 |
| PF01229 | Glyco_hydro_39 | 1.92 |
| PF01850 | PIN | 1.92 |
| PF14376 | Haem_bd | 1.92 |
| PF01103 | Omp85 | 1.92 |
| PF04253 | TFR_dimer | 1.92 |
| PF00171 | Aldedh | 0.96 |
| PF02604 | PhdYeFM_antitox | 0.96 |
| PF03583 | LIP | 0.96 |
| PF00873 | ACR_tran | 0.96 |
| PF05239 | PRC | 0.96 |
| PF12344 | UvrB | 0.96 |
| PF13349 | DUF4097 | 0.96 |
| PF13345 | Obsolete Pfam Family | 0.96 |
| PF01019 | G_glu_transpept | 0.96 |
| PF13545 | HTH_Crp_2 | 0.96 |
| PF10049 | DUF2283 | 0.96 |
| PF01833 | TIG | 0.96 |
| PF09286 | Pro-kuma_activ | 0.96 |
| PF00082 | Peptidase_S8 | 0.96 |
| PF13676 | TIR_2 | 0.96 |
| PF04865 | Baseplate_J | 0.96 |
| PF00202 | Aminotran_3 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0422 | 4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC | Coenzyme transport and metabolism [H] | 25.00 |
| COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 7.69 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 1.92 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.92 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 1.92 |
| COG3664 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 1.92 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 1.92 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 1.92 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.96 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.96 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.96 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.96 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.96 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.96 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.15 % |
| Unclassified | root | N/A | 28.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10290293 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101491269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300005344|Ga0070661_100225717 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300005406|Ga0070703_10409000 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300005533|Ga0070734_10067977 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
| 3300005533|Ga0070734_10171475 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300005602|Ga0070762_10334929 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300005712|Ga0070764_10681332 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005921|Ga0070766_10576598 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300006059|Ga0075017_100847083 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300006059|Ga0075017_101089878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300006086|Ga0075019_10080880 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300006102|Ga0075015_100372018 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300006173|Ga0070716_101500329 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300006175|Ga0070712_101042843 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300006176|Ga0070765_100062334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3094 | Open in IMG/M |
| 3300009098|Ga0105245_10985634 | Not Available | 887 | Open in IMG/M |
| 3300009519|Ga0116108_1020638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2262 | Open in IMG/M |
| 3300009520|Ga0116214_1369965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300009824|Ga0116219_10089062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1805 | Open in IMG/M |
| 3300010048|Ga0126373_10454626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1316 | Open in IMG/M |
| 3300010366|Ga0126379_11476245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300010375|Ga0105239_12172788 | Not Available | 645 | Open in IMG/M |
| 3300010376|Ga0126381_102363251 | Not Available | 763 | Open in IMG/M |
| 3300010379|Ga0136449_100156287 | All Organisms → cellular organisms → Bacteria | 4457 | Open in IMG/M |
| 3300010379|Ga0136449_101728316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter | 941 | Open in IMG/M |
| 3300010379|Ga0136449_102090955 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300011120|Ga0150983_13053933 | Not Available | 871 | Open in IMG/M |
| 3300011270|Ga0137391_11541304 | Not Available | 509 | Open in IMG/M |
| 3300012205|Ga0137362_10336351 | Not Available | 1307 | Open in IMG/M |
| 3300012205|Ga0137362_11009819 | Not Available | 708 | Open in IMG/M |
| 3300012917|Ga0137395_10997970 | Not Available | 600 | Open in IMG/M |
| 3300012927|Ga0137416_11160567 | Not Available | 694 | Open in IMG/M |
| 3300012948|Ga0126375_10867820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300012971|Ga0126369_11764171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300012989|Ga0164305_10477069 | Not Available | 975 | Open in IMG/M |
| 3300013297|Ga0157378_10099187 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2657 | Open in IMG/M |
| 3300014159|Ga0181530_10064306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2321 | Open in IMG/M |
| 3300014165|Ga0181523_10023999 | All Organisms → cellular organisms → Bacteria | 3992 | Open in IMG/M |
| 3300014165|Ga0181523_10361354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300014169|Ga0181531_10051529 | All Organisms → cellular organisms → Bacteria | 2407 | Open in IMG/M |
| 3300014169|Ga0181531_10589563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300015053|Ga0137405_1206811 | Not Available | 831 | Open in IMG/M |
| 3300016319|Ga0182033_11346169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300016404|Ga0182037_12173553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300017927|Ga0187824_10067348 | Not Available | 1120 | Open in IMG/M |
| 3300017933|Ga0187801_10077962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1235 | Open in IMG/M |
| 3300017961|Ga0187778_10181200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300017966|Ga0187776_10993384 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300017972|Ga0187781_10906609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300017972|Ga0187781_11280401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300017975|Ga0187782_11301399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300018007|Ga0187805_10012906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3547 | Open in IMG/M |
| 3300018057|Ga0187858_10263756 | Not Available | 1102 | Open in IMG/M |
| 3300018085|Ga0187772_10489800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 866 | Open in IMG/M |
| 3300018090|Ga0187770_11542219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300020579|Ga0210407_10188433 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
| 3300020580|Ga0210403_10103602 | All Organisms → cellular organisms → Bacteria | 2308 | Open in IMG/M |
| 3300020583|Ga0210401_10229719 | Not Available | 1714 | Open in IMG/M |
| 3300021088|Ga0210404_10552218 | Not Available | 653 | Open in IMG/M |
| 3300021168|Ga0210406_10000871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 39289 | Open in IMG/M |
| 3300021171|Ga0210405_10667681 | Not Available | 805 | Open in IMG/M |
| 3300021401|Ga0210393_10633020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300021401|Ga0210393_11009313 | Not Available | 673 | Open in IMG/M |
| 3300021402|Ga0210385_10440105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300021406|Ga0210386_10773881 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300021478|Ga0210402_10430906 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300021559|Ga0210409_11122468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300022533|Ga0242662_10277022 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300022717|Ga0242661_1006935 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300024271|Ga0224564_1052819 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300025885|Ga0207653_10287141 | Not Available | 636 | Open in IMG/M |
| 3300025911|Ga0207654_11317197 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300025924|Ga0207694_10297764 | Not Available | 1328 | Open in IMG/M |
| 3300025929|Ga0207664_10523865 | Not Available | 1062 | Open in IMG/M |
| 3300025936|Ga0207670_11399862 | Not Available | 594 | Open in IMG/M |
| 3300025981|Ga0207640_10234367 | Not Available | 1414 | Open in IMG/M |
| 3300026557|Ga0179587_10164033 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300026557|Ga0179587_10788869 | Not Available | 626 | Open in IMG/M |
| 3300027330|Ga0207777_1046017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300027545|Ga0209008_1152158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300027895|Ga0209624_10006166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7970 | Open in IMG/M |
| 3300027898|Ga0209067_10095825 | Not Available | 1540 | Open in IMG/M |
| 3300027898|Ga0209067_10279033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
| 3300027911|Ga0209698_11169638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300028566|Ga0302147_10311680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300028906|Ga0308309_10655914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300028906|Ga0308309_11453797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300029986|Ga0302188_10407590 | Not Available | 555 | Open in IMG/M |
| 3300029998|Ga0302271_10377017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300030399|Ga0311353_10682737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300030879|Ga0265765_1070928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300031028|Ga0302180_10146417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1313 | Open in IMG/M |
| 3300031057|Ga0170834_110256163 | Not Available | 692 | Open in IMG/M |
| 3300031231|Ga0170824_127056349 | Not Available | 617 | Open in IMG/M |
| 3300031708|Ga0310686_102172585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300031708|Ga0310686_111119352 | Not Available | 1865 | Open in IMG/M |
| 3300031754|Ga0307475_10077310 | Not Available | 2557 | Open in IMG/M |
| 3300031823|Ga0307478_10866642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300031823|Ga0307478_11807537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300032180|Ga0307471_102467692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300032205|Ga0307472_100715633 | Not Available | 903 | Open in IMG/M |
| 3300032897|Ga0335071_11335968 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300034091|Ga0326724_0006167 | All Organisms → cellular organisms → Bacteria | 14640 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.46% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.73% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.73% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.77% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.88% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.88% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029986 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300029998 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_102902932 | 3300000567 | Peatlands Soil | GPFVKRLGPGAMGAINRIFGFLILAIAVQLVWNGAADFRV* |
| JGIcombinedJ26739_1014912692 | 3300002245 | Forest Soil | LVRRLGPSAVGAINKIFGFLILAIAVQLVWDGVADFGN* |
| Ga0070661_1002257171 | 3300005344 | Corn Rhizosphere | PLVQWLGPNAAGSINRIFGFLILAVAVQLIWDGISEFRT* |
| Ga0070703_104090001 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | LGGPLVARLGPGAVAGITRIFGFLIFAVAVQLVWDGAAKFGK* |
| Ga0070734_100679773 | 3300005533 | Surface Soil | LGPSAVGAINKIFGFLILAIAVQLVWDGVADFNS* |
| Ga0070734_101714751 | 3300005533 | Surface Soil | GGPLVERLGPNATGSINRIFGFLILAVAVQLIWDGISDFRT* |
| Ga0070762_103349292 | 3300005602 | Soil | LGPSAVGAINKIFGFLILAIAVQLVWNGMADFRN* |
| Ga0070764_106813321 | 3300005712 | Soil | VKRLGPGTVGAINRIFGFLILAIAVQLLWDGFAQFGR* |
| Ga0070766_105765981 | 3300005921 | Soil | GPFVKRLGPGALGAINRIFGFLILAIAVQLVWNGAADFRG* |
| Ga0075017_1008470832 | 3300006059 | Watersheds | LVARLGPGAVAGITRIFGFLIFAVAVQLVWDGAADFGH* |
| Ga0075017_1010898781 | 3300006059 | Watersheds | VKRLGPGAVGAINRIFGFLILAIAVQLVWNGAADFRG* |
| Ga0075019_100808801 | 3300006086 | Watersheds | LGPSAVGAINKIFGFLILAIAVQLVWNGIADFKN* |
| Ga0075015_1003720182 | 3300006102 | Watersheds | LGGPLVERLGPGAVAGITRIFGFLIFAVAVQLVWDGVAEFGR* |
| Ga0070716_1015003291 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | PLVARLGPGAVAGITRIFGFLIFAVAVQLVWDGAAKFGK* |
| Ga0070712_1010428432 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GPFVNLLGPSAMGAINRIFGFLILSIAVQLVWNGAADFRH* |
| Ga0070765_1000623341 | 3300006176 | Soil | PLVRRLGPGAVGAINKIFGFLILAIAVQLMWDGAADFGH* |
| Ga0105245_109856342 | 3300009098 | Miscanthus Rhizosphere | RLGGPLVAKLGPGMVAGITRIFGFLIFAVAVQLVWDGIAEFGK* |
| Ga0116108_10206383 | 3300009519 | Peatland | GGPFVKRLGPGVMGAINRIFGFLILAIAVQLVWNGAADFRG* |
| Ga0116214_13699652 | 3300009520 | Peatlands Soil | GGPPVRRLGPSAVGAINKIFGFLILAIAVQLVWNGVADFRN* |
| Ga0116219_100890626 | 3300009824 | Peatlands Soil | LVRRLGPSAVGAINKIFGFLILAIAVQLVWDGVADFNS* |
| Ga0126373_104546261 | 3300010048 | Tropical Forest Soil | VRKLGPTALGAINKICGFLILAIAVQLVCDGIADFKS* |
| Ga0126379_114762452 | 3300010366 | Tropical Forest Soil | LGPGATGAINRIFGFLILAIAVQLIWDGMVDFKA* |
| Ga0105239_121727882 | 3300010375 | Corn Rhizosphere | VAKLGPGAVAGITRIFGFLIFAVAVQLVWDGVADFR* |
| Ga0126381_1023632511 | 3300010376 | Tropical Forest Soil | RLGPSAVGAISRIFGFLILAIAVQLVWDGVAEFKMGQ* |
| Ga0136449_1001562871 | 3300010379 | Peatlands Soil | LGPGAVGAINKIFGFLILAIAVQLVWNGVADFKN* |
| Ga0136449_1017283162 | 3300010379 | Peatlands Soil | GQGAVGSINRIFGFLILAIAVQLVTTGLTDLHVIS* |
| Ga0136449_1020909552 | 3300010379 | Peatlands Soil | LGPNAVGAINKIFGFLILAIAVQLVWDGVADFNS* |
| Ga0150983_130539332 | 3300011120 | Forest Soil | RLGPSAVGAISRIFGFLILAIAVQLVWDGVAEFK* |
| Ga0137391_115413042 | 3300011270 | Vadose Zone Soil | YLFLRLGGPLVAKLGPGAVAGITRIFGFLIFAVAVQLVWDGVADFRQ* |
| Ga0137362_103363512 | 3300012205 | Vadose Zone Soil | VARLGPGAVAGITRIFGFLIFAVAVQLVWDGAAEFGK* |
| Ga0137362_110098192 | 3300012205 | Vadose Zone Soil | YLFLRLGGPLVAKLGPGAVAGITRIFGFLIFAVAVQLVWDGVADFRS* |
| Ga0137395_109979702 | 3300012917 | Vadose Zone Soil | LGPGAVAGITRIFGFLIFAVAVQLVWDGVAEFGK* |
| Ga0137416_111605672 | 3300012927 | Vadose Zone Soil | LVGRLGPSAAGAISRIFGFLILAIAVQLIWDGVADFRG* |
| Ga0126375_108678201 | 3300012948 | Tropical Forest Soil | KLGPSAVGAINKIFGFLILAIAVQLVWDGVADFKS* |
| Ga0126369_117641712 | 3300012971 | Tropical Forest Soil | LGPSAVGAINKIFGFLILAIAVQLVSDGVADFLT* |
| Ga0164305_104770691 | 3300012989 | Soil | PLVAKLGPGAVAGITRIFGFLIFAVAVQLVWDGVADFGK* |
| Ga0157378_100991873 | 3300013297 | Miscanthus Rhizosphere | GPLVAKLGPGMVAGITRIFGFLIFAVAVQLVWDGVAEFGK* |
| Ga0181530_100643061 | 3300014159 | Bog | GPFVKRLGPGVMGAINRIFGFLILAIAVQLVWNGAADFRG* |
| Ga0181523_100239991 | 3300014165 | Bog | LVRRLGPSAVGAINKIFGFLILAIAVQLVWNGAADFRN* |
| Ga0181523_103613542 | 3300014165 | Bog | VRRLGPSAVGAINKIFGFLILAIAVQLVWNGAADFRN* |
| Ga0181531_100515293 | 3300014169 | Bog | VRRLGPTAVGAINKVFGFLILAIAVQLVWDGVADFNS* |
| Ga0181531_105895632 | 3300014169 | Bog | KRLGPGAVGAISRIFGFLILSIAVQLVWDGVADFKG* |
| Ga0137405_12068111 | 3300015053 | Vadose Zone Soil | AQPQRSVYLFLRLGGPLVAKLGPGAVAGITRIFGFLIFAVAVQLVWDGVADFRS* |
| Ga0182033_113461691 | 3300016319 | Soil | VRKLGPSAVGAINKIFGFLILAIAVQLVWNGIAEFKN |
| Ga0182037_121735531 | 3300016404 | Soil | KLGPSAVGAINKIFGFLILAIAVQLVSDGIADFRN |
| Ga0187824_100673482 | 3300017927 | Freshwater Sediment | LRLGGPLVAKLGPGAVAGITRIFGFLIFAVAVQLVWDGAADFGR |
| Ga0187801_100779621 | 3300017933 | Freshwater Sediment | LVRRLGPGAVGAINKIFGFLILAIAVQLVWNGIADFNS |
| Ga0187778_101812001 | 3300017961 | Tropical Peatland | RLGPASVGAINKIFGFLILAIAVQLVWNGVADFNS |
| Ga0187776_109933842 | 3300017966 | Tropical Peatland | VKRLGPGASGAINRIFGFLLLAIAVQLVWDGVADFKA |
| Ga0187781_109066092 | 3300017972 | Tropical Peatland | PFVKRLGPGAVGAINRIFGFLILAIAVQLLWNGAADFRR |
| Ga0187781_112804011 | 3300017972 | Tropical Peatland | RLGPSAVGAINKIFGFLILAIAVQLVWNGVADFRN |
| Ga0187782_113013992 | 3300017975 | Tropical Peatland | VRRLGPSAVGAINKIFGFLILAIAVQLVWDGIADFNG |
| Ga0187805_100129066 | 3300018007 | Freshwater Sediment | RLGPSAVGAINKIFGFLILAIAVQLVWNGMADFRN |
| Ga0187858_102637561 | 3300018057 | Peatland | RLGPGAVGAINKIFGFLILAIAVQLVWDGVADFNR |
| Ga0187772_104898001 | 3300018085 | Tropical Peatland | KRLGPGAVGAINRIFGFLILAIAVQLVWDGVADFRG |
| Ga0187770_115422192 | 3300018090 | Tropical Peatland | VNRLGPGTVGAINRIFGFLILAIAVQLVWNGVADFRS |
| Ga0210407_101884334 | 3300020579 | Soil | VERLGPCATGAINRIFGFLILAIAVQLLWDGVADFK |
| Ga0210403_101036021 | 3300020580 | Soil | LVRRLGPSAVGAINKIFGFLILAIAVQLVWNGVADFRN |
| Ga0210401_102297192 | 3300020583 | Soil | VGRLGPSAVGAISRIFGFLILAIAVQLIWDGVADFKG |
| Ga0210404_105522181 | 3300021088 | Soil | YLFLRLGGPLVARLGPGAVAGITRIFGFLIFAVAVQLVWDGAAKFGK |
| Ga0210406_1000087130 | 3300021168 | Soil | LVERLGPCATGAINRIFGFLILAIAVQLLWDGVADFK |
| Ga0210405_106676811 | 3300021171 | Soil | FLRLGGPLVARMGPGAVAGITRIFGFLIFAVAVQLVWDGVADFRQ |
| Ga0210393_106330202 | 3300021401 | Soil | VLVKRLGPGAAVAIDRIFGFLLLAIAVQLVWNGGP |
| Ga0210393_110093132 | 3300021401 | Soil | LVRRLGPSAVGAINKIFGFLILAIAVQLVWNGMADFRN |
| Ga0210385_104401051 | 3300021402 | Soil | VRRLGPSAVGAINKIFGFLILAIAVQLVWNGMADFHN |
| Ga0210386_107738812 | 3300021406 | Soil | GPWVRRLGPNAVGAINKIFGFLILAIAVQLVWDGVADFHS |
| Ga0210402_104309062 | 3300021478 | Soil | RLGPGAAGGINRIFGFLLLAIAVQLVWDGVADFPH |
| Ga0210409_111224681 | 3300021559 | Soil | VRRLGPSAVGAINKIFGFLILAIAVQLVWNGVADFKS |
| Ga0242662_102770221 | 3300022533 | Soil | RRLGPSAVGAINKIFGFLILAIAVQLVWDGVADFK |
| Ga0242661_10069355 | 3300022717 | Soil | LVERLGPCTTGAITRIFGFLILAIAVQLVWDGVAYFK |
| Ga0224564_10528193 | 3300024271 | Soil | VERLGTCTTGAINRIFGFLILAIAVQLVWDGVAYFK |
| Ga0207653_102871412 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | LRLGGPLVARLGPGAVAGITRIFGFLIFAVAVQLVWDGAAKFGK |
| Ga0207654_113171973 | 3300025911 | Corn Rhizosphere | GGPLVARLGPSAAGAINRIFGFLILSVAVQLLWDGLAEFQFGR |
| Ga0207694_102977642 | 3300025924 | Corn Rhizosphere | LFLRLGGPLVAKLGPGMVAGITRIFGFLIFAVAVQLVWDGVAEFGK |
| Ga0207664_105238652 | 3300025929 | Agricultural Soil | VDRLGPGTVGAINRIFGFLILAIAVQLVWDGVAEFK |
| Ga0207670_113998621 | 3300025936 | Switchgrass Rhizosphere | RLGGPLVAKLGPGAVAGITRIFGFLIFAVAVQLVWDGVADFGK |
| Ga0207640_102343672 | 3300025981 | Corn Rhizosphere | ARLGPNTVGAINRIFGFLILAIAVQLVWDGIADFRG |
| Ga0179587_101640331 | 3300026557 | Vadose Zone Soil | LVRRLGPSAVGAINKIFGFLILAIAVQLVWDGVADFKG |
| Ga0179587_107888691 | 3300026557 | Vadose Zone Soil | PLVGRLGPSAAGAISRIFGFLILAIAVQLIWDGVADFRG |
| Ga0207777_10460172 | 3300027330 | Tropical Forest Soil | LVRRLGPSAVGAINKIFGFLILAIAVQLVWNGVADFKN |
| Ga0209008_11521582 | 3300027545 | Forest Soil | RLGPSAVGAINKIFGFLILAIAVQLVWDGVADFNS |
| Ga0209624_100061664 | 3300027895 | Forest Soil | LWLGEPQARRLGPHAVGVINKIFGFLILAIAVQLVWNGIADFKN |
| Ga0209067_100958251 | 3300027898 | Watersheds | RLGPGAVGAINRIFGFLILAIAVQLVWNGVADFKG |
| Ga0209067_102790331 | 3300027898 | Watersheds | PGAVGAINRIFGFLILAIAVQLIWNGAMDFRGGMPS |
| Ga0209698_111696382 | 3300027911 | Watersheds | VKRLGPGAVGAINRIFGFLILAIAVQLVWNGAAAFHT |
| Ga0302147_103116801 | 3300028566 | Bog | RLGPGAVGAINRIFGFLILAIAVQLVWNGMADFHR |
| Ga0308309_106559141 | 3300028906 | Soil | RRLGPGAVGAINKIFGFLILAIAVQLMWDGAADFGH |
| Ga0308309_114537971 | 3300028906 | Soil | RRLGPSAVGAINKIFGFLILAIAVQLVWNGMADFHN |
| Ga0302188_104075901 | 3300029986 | Bog | LVRRLGPSAVGAINKIFGFLILAIAVQLVWDGVADFKS |
| Ga0302271_103770172 | 3300029998 | Bog | RLGPGAIGAINRIFGFLILAIAVQLVWDGVVDFRA |
| Ga0311353_106827372 | 3300030399 | Palsa | VRRLGPSAVGAINKIFGFLILAIAVQLVWDGVADFKN |
| Ga0265765_10709281 | 3300030879 | Soil | RWLGPNAVGAINKIFGFLILAIAVQLVWDGVADFGS |
| Ga0302180_101464173 | 3300031028 | Palsa | RLGPSAVGAINKIFGFLILAIAVQLVWDGVADFKG |
| Ga0170834_1102561632 | 3300031057 | Forest Soil | FWMGGPLVGRLGPSAVGAINKIFCFLILAIAVQLVWDGVADFKT |
| Ga0170824_1270563492 | 3300031231 | Forest Soil | FWMGGPLVGRLGPSAVGAINKIFCFLILAIAVQLVWDGVADFRS |
| Ga0310686_1021725851 | 3300031708 | Soil | LVRRLGPSAVGAINKIFGFLILAIAVQLVWDGVADFRT |
| Ga0310686_1111193524 | 3300031708 | Soil | VRRLGPNAVGAINKIFGFLILAIAVQLVWDGVADFHS |
| Ga0307475_100773103 | 3300031754 | Hardwood Forest Soil | VKRLGPGATGAINRIFGFLILALAVQLVWDGAAQFSR |
| Ga0307478_108666422 | 3300031823 | Hardwood Forest Soil | MVRRLGPSAVGAINKIFGFLILAIAVQLVWDGVADFGN |
| Ga0307478_118075371 | 3300031823 | Hardwood Forest Soil | RLGPNAVGAINKIFGFLILAIAVQLVWDGVADFKS |
| Ga0307471_1024676922 | 3300032180 | Hardwood Forest Soil | QLGPSAVGAISRIFGFLILAFAVQLIWDGVADFRV |
| Ga0307472_1007156331 | 3300032205 | Hardwood Forest Soil | FVNLLGPSAMGAINRIFGFLILSIAVQLVWNGAADFQH |
| Ga0335071_113359683 | 3300032897 | Soil | GPTATGAINRIFGFLILSVAVQLIWDGLAEFQFVK |
| Ga0326724_0006167_14533_14640 | 3300034091 | Peat Soil | RLGPGAVGAIARIFGFLILAIAVQLVWDGVADFRG |
| ⦗Top⦘ |