


| Basic Information | |
|---|---|
| Family ID | F097872 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSAFDAVDGSSTGTEVPCMWVLLRPPRFGGAKHASGHDNR |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 64.42 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.23 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.846 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (13.462 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.923 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.038 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.88% β-sheet: 0.00% Coil/Unstructured: 94.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 24.04 |
| PF02371 | Transposase_20 | 12.50 |
| PF01548 | DEDD_Tnp_IS110 | 2.88 |
| PF03401 | TctC | 1.92 |
| PF06742 | DUF1214 | 1.92 |
| PF02518 | HATPase_c | 1.92 |
| PF02353 | CMAS | 1.92 |
| PF01925 | TauE | 0.96 |
| PF08238 | Sel1 | 0.96 |
| PF00072 | Response_reg | 0.96 |
| PF17200 | sCache_2 | 0.96 |
| PF13458 | Peripla_BP_6 | 0.96 |
| PF00873 | ACR_tran | 0.96 |
| PF11752 | DUF3309 | 0.96 |
| PF01734 | Patatin | 0.96 |
| PF13474 | SnoaL_3 | 0.96 |
| PF01220 | DHquinase_II | 0.96 |
| PF02040 | ArsB | 0.96 |
| PF00486 | Trans_reg_C | 0.96 |
| PF00596 | Aldolase_II | 0.96 |
| PF07045 | DUF1330 | 0.96 |
| PF00271 | Helicase_C | 0.96 |
| PF00589 | Phage_integrase | 0.96 |
| PF05988 | DUF899 | 0.96 |
| PF12951 | PATR | 0.96 |
| PF00999 | Na_H_Exchanger | 0.96 |
| PF13683 | rve_3 | 0.96 |
| PF13374 | TPR_10 | 0.96 |
| PF07883 | Cupin_2 | 0.96 |
| PF02558 | ApbA | 0.96 |
| PF00884 | Sulfatase | 0.96 |
| PF03641 | Lysine_decarbox | 0.96 |
| PF12833 | HTH_18 | 0.96 |
| PF00300 | His_Phos_1 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 24.04 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 15.38 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.92 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 1.92 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 1.92 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.92 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 1.92 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 1.92 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.96 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 0.96 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.96 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.96 |
| COG0757 | 3-dehydroquinate dehydratase | Amino acid transport and metabolism [E] | 0.96 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 0.96 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.96 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.96 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.96 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.96 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.96 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.96 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.96 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.96 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.85 % |
| Unclassified | root | N/A | 21.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000655|AF_2010_repII_A100DRAFT_1016225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1416 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1040218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10024748 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1426 | Open in IMG/M |
| 3300000816|AF_2010_repII_A10DRAFT_1010471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 972 | Open in IMG/M |
| 3300004092|Ga0062389_102795049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300005172|Ga0066683_10258736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1079 | Open in IMG/M |
| 3300005332|Ga0066388_101183800 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300005332|Ga0066388_104611879 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005332|Ga0066388_108031923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 527 | Open in IMG/M |
| 3300005434|Ga0070709_10305821 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300005436|Ga0070713_100359554 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300005471|Ga0070698_101364143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangxiense | 659 | Open in IMG/M |
| 3300005518|Ga0070699_100881339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangxiense | 819 | Open in IMG/M |
| 3300005536|Ga0070697_100862302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium guangxiense | 802 | Open in IMG/M |
| 3300005536|Ga0070697_101979820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300005556|Ga0066707_10492549 | Not Available | 795 | Open in IMG/M |
| 3300005764|Ga0066903_101572669 | Not Available | 1245 | Open in IMG/M |
| 3300005764|Ga0066903_102244699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1053 | Open in IMG/M |
| 3300005764|Ga0066903_102648857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 972 | Open in IMG/M |
| 3300005764|Ga0066903_102671127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 968 | Open in IMG/M |
| 3300005764|Ga0066903_103172705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 889 | Open in IMG/M |
| 3300005764|Ga0066903_104972045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 705 | Open in IMG/M |
| 3300005764|Ga0066903_105025577 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300005764|Ga0066903_105204381 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300005764|Ga0066903_108026305 | Not Available | 541 | Open in IMG/M |
| 3300005764|Ga0066903_108206359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 534 | Open in IMG/M |
| 3300005764|Ga0066903_108525055 | Not Available | 522 | Open in IMG/M |
| 3300006028|Ga0070717_10064287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3047 | Open in IMG/M |
| 3300006028|Ga0070717_10187572 | Not Available | 1805 | Open in IMG/M |
| 3300006031|Ga0066651_10125252 | Not Available | 1324 | Open in IMG/M |
| 3300006046|Ga0066652_100040622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3426 | Open in IMG/M |
| 3300006173|Ga0070716_101521533 | Not Available | 547 | Open in IMG/M |
| 3300006175|Ga0070712_101209040 | Not Available | 657 | Open in IMG/M |
| 3300006175|Ga0070712_101288752 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300006354|Ga0075021_10600429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 702 | Open in IMG/M |
| 3300006755|Ga0079222_10861235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 752 | Open in IMG/M |
| 3300006852|Ga0075433_10999859 | Not Available | 728 | Open in IMG/M |
| 3300006854|Ga0075425_100707890 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300006871|Ga0075434_100568332 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300006904|Ga0075424_100230003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1970 | Open in IMG/M |
| 3300006914|Ga0075436_101261177 | Not Available | 559 | Open in IMG/M |
| 3300007076|Ga0075435_101423857 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300009148|Ga0105243_11864669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 633 | Open in IMG/M |
| 3300009153|Ga0105094_10646139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300009524|Ga0116225_1243391 | Not Available | 808 | Open in IMG/M |
| 3300009644|Ga0116121_1179040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
| 3300010043|Ga0126380_10554691 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300010046|Ga0126384_11108164 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300010046|Ga0126384_11373346 | Not Available | 658 | Open in IMG/M |
| 3300010361|Ga0126378_13005149 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300010379|Ga0136449_100281195 | All Organisms → cellular organisms → Bacteria | 3055 | Open in IMG/M |
| 3300010398|Ga0126383_12764380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 573 | Open in IMG/M |
| 3300011119|Ga0105246_10478200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1053 | Open in IMG/M |
| 3300012198|Ga0137364_10624806 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 812 | Open in IMG/M |
| 3300012204|Ga0137374_10270532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1411 | Open in IMG/M |
| 3300012211|Ga0137377_10799265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium phyllosphaerae | 876 | Open in IMG/M |
| 3300012355|Ga0137369_10625569 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300012923|Ga0137359_10276884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1496 | Open in IMG/M |
| 3300012923|Ga0137359_11378910 | Not Available | 593 | Open in IMG/M |
| 3300012923|Ga0137359_11793941 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012971|Ga0126369_11107818 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300016270|Ga0182036_10566298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 907 | Open in IMG/M |
| 3300016341|Ga0182035_10461492 | Not Available | 1079 | Open in IMG/M |
| 3300016341|Ga0182035_11903459 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300016371|Ga0182034_10392804 | Not Available | 1136 | Open in IMG/M |
| 3300016371|Ga0182034_11318192 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300016422|Ga0182039_10542866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1009 | Open in IMG/M |
| 3300016422|Ga0182039_10865483 | Not Available | 805 | Open in IMG/M |
| 3300017961|Ga0187778_11357565 | Not Available | 502 | Open in IMG/M |
| 3300017974|Ga0187777_10050945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2665 | Open in IMG/M |
| 3300018023|Ga0187889_10255526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 787 | Open in IMG/M |
| 3300018024|Ga0187881_10410040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300018072|Ga0184635_10082174 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1265 | Open in IMG/M |
| 3300018089|Ga0187774_10784790 | Not Available | 641 | Open in IMG/M |
| 3300019082|Ga0187852_1042698 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2139 | Open in IMG/M |
| 3300019875|Ga0193701_1024165 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1246 | Open in IMG/M |
| 3300020140|Ga0179590_1152525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 632 | Open in IMG/M |
| 3300021474|Ga0210390_10032574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4255 | Open in IMG/M |
| 3300021560|Ga0126371_13275955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300025498|Ga0208819_1018711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1949 | Open in IMG/M |
| 3300025878|Ga0209584_10267488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 656 | Open in IMG/M |
| 3300025928|Ga0207700_11038296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
| 3300025985|Ga0210117_1099277 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300026307|Ga0209469_1097940 | Not Available | 819 | Open in IMG/M |
| 3300026490|Ga0257153_1013623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1640 | Open in IMG/M |
| 3300027873|Ga0209814_10486574 | Not Available | 546 | Open in IMG/M |
| 3300031546|Ga0318538_10204967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1053 | Open in IMG/M |
| 3300031573|Ga0310915_10264691 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300031679|Ga0318561_10333124 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 831 | Open in IMG/M |
| 3300031681|Ga0318572_10261038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1020 | Open in IMG/M |
| 3300031713|Ga0318496_10324436 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 850 | Open in IMG/M |
| 3300031744|Ga0306918_10942398 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300031781|Ga0318547_10244257 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1081 | Open in IMG/M |
| 3300031835|Ga0318517_10267293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 772 | Open in IMG/M |
| 3300031859|Ga0318527_10316710 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
| 3300031890|Ga0306925_11049210 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300031910|Ga0306923_11025832 | Not Available | 894 | Open in IMG/M |
| 3300032043|Ga0318556_10102115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1452 | Open in IMG/M |
| 3300032044|Ga0318558_10056528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1750 | Open in IMG/M |
| 3300032051|Ga0318532_10089428 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1081 | Open in IMG/M |
| 3300032064|Ga0318510_10067869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1301 | Open in IMG/M |
| 3300032180|Ga0307471_104042003 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300032205|Ga0307472_100976058 | Not Available | 791 | Open in IMG/M |
| 3300032261|Ga0306920_101065090 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 13.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.85% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.92% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000816 | Forest soil microbial communities from Amazon forest - 2010 replicate II A10 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025985 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A100DRAFT_10162253 | 3300000655 | Forest Soil | LHMSAFDAVDGSSMGTRVPLMWGLLRLPRFGGAKHANGYDNRF* |
| AF_2010_repII_A100DRAFT_10402181 | 3300000655 | Forest Soil | AAFDAVDGSSTGTRVPSMWALLKIPRFEGATHANDRDDWS* |
| AF_2010_repII_A001DRAFT_100247481 | 3300000793 | Forest Soil | FAAVHESAFDAVDGSSMGTRVPLMWGLLRLPRFGGAKHANGYDNRF* |
| AF_2010_repII_A10DRAFT_10104712 | 3300000816 | Forest Soil | LSDGFFAALHMSAFDAVDGSSMGTRVPLMWGLLRLPRFGGAKHANGYDNRF* |
| Ga0062389_1027950491 | 3300004092 | Bog Forest Soil | MSAIDAVDGSSTGTRVPWIWGLLSAPRFRGESYANGYNSR |
| Ga0066683_102587364 | 3300005172 | Soil | MPAHESAVDAVDGSSTGTEVPWMWVLLRPPRFGGATHASGHDN |
| Ga0066388_1011838001 | 3300005332 | Tropical Forest Soil | VRFAAVRKSAFDAVDGSSTGTEVPSMWALLRLPRFGGANHAD |
| Ga0066388_1046118791 | 3300005332 | Tropical Forest Soil | VTELPRDRLFAAVRKSAFDAVDGSSTGTEVPSMWALLRLPRFGGANHAD |
| Ga0066388_1080319232 | 3300005332 | Tropical Forest Soil | MLHLLTSAFDAVDGSSTGTRVPSTWSLLRLPRFGGAKHASGHN |
| Ga0070709_103058212 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALDAVDGSSTGTEVPCMWVLLRPPRFGGAKHASGHDNRSRH |
| Ga0070713_1003595543 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSALDAVDGSSTGTEVPCMWVLLRPPRFGGAKHASGHDNR |
| Ga0070698_1013641431 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VQFAALHMSAIDAVDGSSTGTEVPSMWALLRLPRFGGANHADGHDNR |
| Ga0070699_1008813392 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VQFAALHMSAIDAVDGSSTGTEVPSMWALLRLPRFGGANHADGHDN |
| Ga0070697_1008623022 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VQFAALHMSAIDAVDGSSTGTEVPSMWALLRLPRFGGANHADGH |
| Ga0070697_1019798201 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSANDAVDGSSTGTEVPWMWVLLRPPRFGGATHASGHDNW |
| Ga0066707_104925493 | 3300005556 | Soil | MTAFDAVDGSSTGTEVPWMWVLLRPPRFGGATHASGHDNWS |
| Ga0066903_1015726691 | 3300005764 | Tropical Forest Soil | LLHLLRSGIDAVDGSSTGTRVPWMWGLLRLPRFGGAIHANGYDDRSR |
| Ga0066903_1022446991 | 3300005764 | Tropical Forest Soil | MLFAAVHESAFDAVDGSSTGTRVPLMWGLLRLPRFGGAKHANGYDNR |
| Ga0066903_1026488571 | 3300005764 | Tropical Forest Soil | MSAFDAVDGSSTGTEVPWMWVLLRPPRFGGAKHASGH |
| Ga0066903_1026711271 | 3300005764 | Tropical Forest Soil | VIYIAMTAHDAVDGSSTGTRVPWMWGLIKLPRFGGATHANHYDNRS |
| Ga0066903_1031727054 | 3300005764 | Tropical Forest Soil | MCFAAVRKSGFDAVDGFSTGTEVPWMWVLLRPLRLGGAKYAN |
| Ga0066903_1049720451 | 3300005764 | Tropical Forest Soil | VHESGFDAVDGSSTGTEVPWMWVLLRPLRLGGAKYAN |
| Ga0066903_1050255772 | 3300005764 | Tropical Forest Soil | MTFLTSVNDAVDGSSTGTRVPKMWALLTLPRFGGAKHANGYDNRSR |
| Ga0066903_1052043811 | 3300005764 | Tropical Forest Soil | MSAFDAVDGSSTGTRVPWMWGLLEAPTIGGAIYANGYDD |
| Ga0066903_1080263052 | 3300005764 | Tropical Forest Soil | MSAIDAVDGSSTGTEVPWMWVLLRPPRFGGAKMQTITTVG |
| Ga0066903_1082063592 | 3300005764 | Tropical Forest Soil | VRASFAAVHESAFDAVDGSSTGTEVPWMWVLLRPPRFGGAKHASGH |
| Ga0066903_1085250551 | 3300005764 | Tropical Forest Soil | MSVIDAVDGSSTGTRVPKMWALLTLPRFGGAKHANGYDNRSRH |
| Ga0070717_100642874 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAFDAVDGSSTGTEVPCMWVLLRPPRFGGAKHASGHD |
| Ga0070717_101875722 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAFDAVDGSSTGTEVPCMWVLLRPPRFGGAKHAS |
| Ga0066651_101252522 | 3300006031 | Soil | MSESDAVDGSCTGTEVPCMWVLLRAPRFGGAKHASGHDNRSRH |
| Ga0066652_1000406228 | 3300006046 | Soil | MSESDAVDGSCTGTEVPCMWVLLRAPRFGGAKHASGHDNRSRHCKKTDTNE |
| Ga0070716_1015215332 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMSAFDAVDGSSTGTEVPCMWVLLRPPRFGGAKHASGHDNR |
| Ga0070712_1012090401 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRMSTFDAVDGSSTGTEVPCMWVLLRPPRFGGAKHASGHDNRSR |
| Ga0070712_1012887522 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAAVHWAALDAVDGSSTGTEVPCMWVLLRPPRFG |
| Ga0075021_106004292 | 3300006354 | Watersheds | MLFAAVHMSAPDAVDGSSTGTRVPKKWALLRLPRFGGASHANGFD |
| Ga0079222_108612352 | 3300006755 | Agricultural Soil | LLHLLTSAVDAVDGSSTGTEVPWLWVLLRPPRFGGAK |
| Ga0075433_109998593 | 3300006852 | Populus Rhizosphere | MSAFDAVDGSSTGTEVPCMWVLLRPPRFGGAKHASGHDNR |
| Ga0075425_1007078901 | 3300006854 | Populus Rhizosphere | LLHLLMAAFDAVDGSSTGTEVPWMWVLLRPPRFGGATHASGHDNWSR |
| Ga0075434_1005683321 | 3300006871 | Populus Rhizosphere | LLHLLMAAFDAVDGSSTGTEVPWMWVLLRPPRFGGATHASGHDNW |
| Ga0075424_1002300033 | 3300006904 | Populus Rhizosphere | LLRLLTAASDAVDGSSTGTEVPCMWVLLRPPRFGGAKHASGHDNRS |
| Ga0075436_1012611772 | 3300006914 | Populus Rhizosphere | LAVCFLLSARDAVDGSSTGTEVPWMWVLLRPPRFGGAT |
| Ga0075435_1014238571 | 3300007076 | Populus Rhizosphere | MFAAVHWAALDAVDGSSTGTEVPCMWVLLRPPRFGGAKHASGHDNR |
| Ga0105243_118646691 | 3300009148 | Miscanthus Rhizosphere | MATPFAALRESVLDAVDGSSTGTSVPWMWGLLRLPRFRGASHAD |
| Ga0105094_106461393 | 3300009153 | Freshwater Sediment | MSVSDAVDGSSTGTGVPLMWVLLELPRFGGAKHASGYNHRSRHREVGVS |
| Ga0116225_12433911 | 3300009524 | Peatlands Soil | MIGLFAAVHESVSDAVDGSSTGTRVPKMGAPIRLPRFGGASHAS |
| Ga0116121_11790401 | 3300009644 | Peatland | MIGLFAAVHESVSDAVDGSSTGTRVPKMGAPIRLPRFGGASHASCHDN |
| Ga0126380_105546911 | 3300010043 | Tropical Forest Soil | MRMSASDAVDGSSTGTEVPLKWVLLRPPRFGGAKHASGHDNRSRY |
| Ga0126384_111081641 | 3300010046 | Tropical Forest Soil | MSAFDAVDGSSTGTEVPWMWVLLRPPRFGGAKHASGHDNWS |
| Ga0126384_113733462 | 3300010046 | Tropical Forest Soil | VRASFAAVHESAFDAVDGSSTGTEVPWMWVLLRPPRFGGAKHASGHDNWS |
| Ga0126378_130051491 | 3300010361 | Tropical Forest Soil | MFLLQRRMSAFDAVDGSSTGTRVPSTWSLLRLPRFGGAKHASGHNN |
| Ga0136449_1002811954 | 3300010379 | Peatlands Soil | MLFAAVHMSAPDAVDGSSTGTRVPKKWALLRLPRFGGASHANGFDHWSRHR |
| Ga0126383_127643801 | 3300010398 | Tropical Forest Soil | MRMSAFDAVDGSSTGTEVPWMWVLLKPPRFGGAKYANCHDNRSRYREVG |
| Ga0105246_104782002 | 3300011119 | Miscanthus Rhizosphere | MFAIDAVDGSSTGTQVPWMWVLLMLPRFGGANHANGHNHRSR |
| Ga0137364_106248062 | 3300012198 | Vadose Zone Soil | MADHTDAGPLFAAVHESGSDAVDGSSTGTRVPRMWALLRLPRFKGAIHADDHDNR |
| Ga0137374_102705324 | 3300012204 | Vadose Zone Soil | MKRHFAAAHESANDAVDGSSTGTEVPWMWVLLRPPRFGGA |
| Ga0137377_107992652 | 3300012211 | Vadose Zone Soil | MSAPDAVDGSSTGAEVPWMWVLLRPPRFGGAKYANDQDNRSRYREVDFS |
| Ga0137369_106255691 | 3300012355 | Vadose Zone Soil | MTAFDAVDGSSTGTEVPWMWVLLRPPRFGGAKHASGHDNWS |
| Ga0137359_102768841 | 3300012923 | Vadose Zone Soil | MTMLFAAVHESACDAVDGSSTGTRVPRMWALLRLPRFRGATHADGHDNRF |
| Ga0137359_113789102 | 3300012923 | Vadose Zone Soil | MSANLEVKRTTAFDAVDGSSTGTEVPWMWVLLRPPRFGGATHASGHDNRSRYR |
| Ga0137359_117939412 | 3300012923 | Vadose Zone Soil | MQFAAVHESVPDAVDGSSTGTRVPRMWALLRLPRFRGASHADDH |
| Ga0126369_111078183 | 3300012971 | Tropical Forest Soil | MSAFDAVDGSSTGTEVPWMWVLLRPPRFGGAKHASGHDDRS |
| Ga0182036_105662981 | 3300016270 | Soil | LLRLLTAAFDAVDGSSTGTEVPWMWVLLRPPRFGGSKHASGHDDRS |
| Ga0182035_104614921 | 3300016341 | Soil | MLTTRAGIFAVHKSAFDAVDGSSTGTEVPWMWVLLRPPRFGGSKHASGHDDR |
| Ga0182035_119034591 | 3300016341 | Soil | MIFAALHESAFDAVDGSSTGTEVPWMWVLLRPPRFGGSKHASGHDDR |
| Ga0182034_103928042 | 3300016371 | Soil | MLFAAAHQSGFDAVDGSSTGTEVPWMWVLLRPPRFGGA |
| Ga0182034_113181921 | 3300016371 | Soil | MIFAALHESAFDAVDGSSTGTEVPWMWVLLRPPRFGGSKHASGHDDRS |
| Ga0182039_105428662 | 3300016422 | Soil | VHFAAVHMSAFDAVDGSSTGTEVPWMWVLLRPPRFGGSKHASG |
| Ga0182039_108654832 | 3300016422 | Soil | MLFAAAHQSGFDAVDGSSTGTEVPWMWVLLRPPRFGG |
| Ga0187778_113575651 | 3300017961 | Tropical Peatland | MSAIDAVDGSSTGTQVPLMWVLLRPPQFGGAKYAIDHDRRFRY |
| Ga0187777_100509458 | 3300017974 | Tropical Peatland | LIENQPMSAIDAVDGSSTGTQVPLMWVLLRPPQFGGAKYAIDHD |
| Ga0187889_102555262 | 3300018023 | Peatland | MIGLFAAVHESVSDAVDGSSTGTRVPKMGAPIRLPRFGGASHASCHD |
| Ga0187881_104100401 | 3300018024 | Peatland | MIGLFAAVHESVSDAVDGSSTGTRVPKMGAPIRLPRFGGASH |
| Ga0184635_100821742 | 3300018072 | Groundwater Sediment | EFDAVDGSSTGTRVPQLWEQLRLPRFGGAIHANGYDNRS |
| Ga0187774_107847902 | 3300018089 | Tropical Peatland | MVMSVLDAVDGSSTGTQVPLMWVLLRPPQFGGAKYAIDHDR |
| Ga0187852_10426981 | 3300019082 | Peatland | MQETAFDAVDGSSTGTRVPKMGAPIRLPRFGGASHASCHDNR |
| Ga0193701_10241651 | 3300019875 | Soil | ECDAVDGSSTGTRVPQLWEQLRLPRFGGAIHANGYDNRS |
| Ga0179590_11525251 | 3300020140 | Vadose Zone Soil | MLVAVHESAFDAVDGSSTGTRVPRMWALLRLPRFRGASHADD |
| Ga0210390_100325749 | 3300021474 | Soil | MSAFDAVDGSSTGTRVPRMWELLRLPRFRGVSHANQRSEPCK |
| Ga0126371_132759551 | 3300021560 | Tropical Forest Soil | MRKSAFDAVDGSSTGTAVPWMWVLLRPPRFGGAKHA |
| Ga0208819_10187111 | 3300025498 | Peatland | MIGLFAAVHESVSDAVDGSSTGTRVPKMGAPIRLPRFGGASHASC |
| Ga0209584_102674881 | 3300025878 | Arctic Peat Soil | MLFAAVHESVVDAVDGSSTGTSVPWMWALLRLPRFRGASHADD |
| Ga0207700_110382961 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAALLRLLTAAFDAVDGSSTGTEVPWMWVLLRPPRFGGATHASGHDNRSRY |
| Ga0210117_10992771 | 3300025985 | Natural And Restored Wetlands | MSTFDAVDGSSTGTQVPWMWVLLMLPRFGGANHASDYHNRFRHSEVGV |
| Ga0209469_10979402 | 3300026307 | Soil | MPGFDAVDGSSTGTEVPWMWVLLRPPRFGGATHASGHDNWSRYRQ |
| Ga0257153_10136231 | 3300026490 | Soil | MTMLFAAVHESGCDAVDGSSTGTRVPRMRALIRPPRFGGGNYASDYDNRSGYSQ |
| Ga0209814_104865741 | 3300027873 | Populus Rhizosphere | LAVCFLLSARDAVDGSSTGTEVPWMWVLLRPPRFGGA |
| Ga0318538_102049671 | 3300031546 | Soil | AALHMSAFDAVDGSSTGTRVPLMWGLLRLPRFGGDKHANGYDNRF |
| Ga0310915_102646912 | 3300031573 | Soil | MLFAAAHQSGFDAVDGSSTGTEVPWMWVLLRPPRFGGATHASDYDD |
| Ga0318561_103331241 | 3300031679 | Soil | VDGSFTGTRVPSTWSLLKLPRFGGAKHASGHNNRF |
| Ga0318572_102610382 | 3300031681 | Soil | HMSAFDAVDGSSTGTRVPLMWGLLRLPRFGGAKHANGYDNRF |
| Ga0318496_103244361 | 3300031713 | Soil | MSAFDAVDGSSTGTEVPWMWVLLKPPRFGGAKYANCHD |
| Ga0306918_109423981 | 3300031744 | Soil | MSAFDAVDGSSTGTQVPWMWVLLKAPRFEGANHANDH |
| Ga0318547_102442571 | 3300031781 | Soil | AAPHMSAFDAVDGSSTGTRVPLMWGLLRLPRFGGDKHANGYDNRF |
| Ga0318517_102672932 | 3300031835 | Soil | HMSTFDAVDGSSTGTRVPLMWGLLRLPRFGGDKHAKGYDNRF |
| Ga0318527_103167102 | 3300031859 | Soil | AFDAVDGSSTGTRVPLMWGLLRLPRFGGDKHAKGYDNRF |
| Ga0306925_110492101 | 3300031890 | Soil | MIFAALHESAFDAVDGSSTGTEVPWMWVLLRPPRFGGSKHA |
| Ga0306923_110258322 | 3300031910 | Soil | MLFAAAHQSGFDAVDGSSTGTEVPWMWVLLRPPRFGGAT |
| Ga0318556_101021152 | 3300032043 | Soil | SRIAAVHMSTFDAVDGSSTGTRVPLMWGLLRLPRFGGDKHANGYDNRF |
| Ga0318558_100565281 | 3300032044 | Soil | KIAAPHMSAFDAVDGSSTGTRVPLMWGLLRLPRFGGDKHAKGYDNRF |
| Ga0318532_100894282 | 3300032051 | Soil | AAPHMSAFDAVDGSSTGTRVPLMWGLLRLPRFGGDKHAKGYDNRF |
| Ga0318510_100678692 | 3300032064 | Soil | SNNDKIAAPHMSAFDAVDGSSTGTRVPLMWGLLRLPRFGGDKHANGYDNRF |
| Ga0307471_1040420031 | 3300032180 | Hardwood Forest Soil | MSAPDAVDGSSTGTEVPSMWALLRLPRFGGANHADGHDNRPRHRK |
| Ga0307472_1009760583 | 3300032205 | Hardwood Forest Soil | MKLFAAVHESGFDAVDGSSTGTEVPWMWVLLRPPRFRGAKHASGHDNRSRHRK |
| Ga0306920_1010650902 | 3300032261 | Soil | MIFAALHESAFDAVDGSSTGTEVPWMWVLLRPPRFGGSKHASGHDDRSRYR |
| ⦗Top⦘ |