


| Basic Information | |
|---|---|
| Family ID | F097866 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPSEVSTIGGDQSGEELRRELAEAREQQAATAEILAAVSNSPT |
| Number of Associated Samples | 58 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 95.19 % |
| % of genes near scaffold ends (potentially truncated) | 97.12 % |
| % of genes from short scaffolds (< 2000 bps) | 89.42 % |
| Associated GOLD sequencing projects | 54 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.885 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (29.808 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.962 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (73.077 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.70% β-sheet: 0.00% Coil/Unstructured: 49.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00589 | Phage_integrase | 2.88 |
| PF04986 | Y2_Tnp | 1.92 |
| PF01757 | Acyl_transf_3 | 1.92 |
| PF00561 | Abhydrolase_1 | 1.92 |
| PF13191 | AAA_16 | 0.96 |
| PF07729 | FCD | 0.96 |
| PF04392 | ABC_sub_bind | 0.96 |
| PF00078 | RVT_1 | 0.96 |
| PF12680 | SnoaL_2 | 0.96 |
| PF13482 | RNase_H_2 | 0.96 |
| PF05598 | DUF772 | 0.96 |
| PF04879 | Molybdop_Fe4S4 | 0.96 |
| PF00344 | SecY | 0.96 |
| PF03050 | DDE_Tnp_IS66 | 0.96 |
| PF14319 | Zn_Tnp_IS91 | 0.96 |
| PF13701 | DDE_Tnp_1_4 | 0.96 |
| PF02371 | Transposase_20 | 0.96 |
| PF03446 | NAD_binding_2 | 0.96 |
| PF14317 | YcxB | 0.96 |
| PF01695 | IstB_IS21 | 0.96 |
| PF13649 | Methyltransf_25 | 0.96 |
| PF07883 | Cupin_2 | 0.96 |
| PF05231 | MASE1 | 0.96 |
| PF00884 | Sulfatase | 0.96 |
| PF13185 | GAF_2 | 0.96 |
| PF00817 | IMS | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.96 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.96 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.96 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.96 |
| COG0201 | Preprotein translocase subunit SecY | Intracellular trafficking, secretion, and vesicular transport [U] | 0.96 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.96 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.96 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.96 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.88 % |
| All Organisms | root | All Organisms | 47.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0522483 | Not Available | 1116 | Open in IMG/M |
| 3300000789|JGI1027J11758_11175980 | Not Available | 517 | Open in IMG/M |
| 3300000955|JGI1027J12803_104360296 | Not Available | 539 | Open in IMG/M |
| 3300004633|Ga0066395_10436141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium meliloti | 744 | Open in IMG/M |
| 3300004633|Ga0066395_11025231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300005332|Ga0066388_100014044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6528 | Open in IMG/M |
| 3300005332|Ga0066388_101165843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1313 | Open in IMG/M |
| 3300005332|Ga0066388_101720455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium | 1111 | Open in IMG/M |
| 3300005332|Ga0066388_106098993 | Not Available | 609 | Open in IMG/M |
| 3300005332|Ga0066388_108848001 | Not Available | 500 | Open in IMG/M |
| 3300005713|Ga0066905_100092273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2028 | Open in IMG/M |
| 3300005713|Ga0066905_100502173 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300005713|Ga0066905_101858528 | Not Available | 556 | Open in IMG/M |
| 3300005713|Ga0066905_102002268 | Not Available | 537 | Open in IMG/M |
| 3300005713|Ga0066905_102179760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300005713|Ga0066905_102233793 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005764|Ga0066903_100426451 | All Organisms → cellular organisms → Bacteria | 2200 | Open in IMG/M |
| 3300005764|Ga0066903_100438652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2174 | Open in IMG/M |
| 3300005764|Ga0066903_100951150 | Not Available | 1563 | Open in IMG/M |
| 3300005764|Ga0066903_100969985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1549 | Open in IMG/M |
| 3300005764|Ga0066903_103259550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 877 | Open in IMG/M |
| 3300005764|Ga0066903_103331969 | Not Available | 868 | Open in IMG/M |
| 3300005764|Ga0066903_105208345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 688 | Open in IMG/M |
| 3300006173|Ga0070716_101731935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 516 | Open in IMG/M |
| 3300006755|Ga0079222_10813363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 766 | Open in IMG/M |
| 3300006796|Ga0066665_10742937 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300006904|Ga0075424_102195268 | Not Available | 581 | Open in IMG/M |
| 3300006904|Ga0075424_102830982 | Not Available | 505 | Open in IMG/M |
| 3300009100|Ga0075418_10359877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1554 | Open in IMG/M |
| 3300009156|Ga0111538_10837455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1165 | Open in IMG/M |
| 3300009156|Ga0111538_13907324 | Not Available | 515 | Open in IMG/M |
| 3300009156|Ga0111538_14135519 | Not Available | 501 | Open in IMG/M |
| 3300009792|Ga0126374_11060379 | Not Available | 640 | Open in IMG/M |
| 3300009792|Ga0126374_11343989 | Not Available | 579 | Open in IMG/M |
| 3300009792|Ga0126374_11810348 | Not Available | 511 | Open in IMG/M |
| 3300010046|Ga0126384_10154183 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300010046|Ga0126384_10912758 | Not Available | 794 | Open in IMG/M |
| 3300010047|Ga0126382_10066350 | Not Available | 2191 | Open in IMG/M |
| 3300010047|Ga0126382_10110822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1797 | Open in IMG/M |
| 3300010047|Ga0126382_10730208 | Not Available | 835 | Open in IMG/M |
| 3300010047|Ga0126382_11698537 | Not Available | 589 | Open in IMG/M |
| 3300010047|Ga0126382_12075289 | Not Available | 543 | Open in IMG/M |
| 3300010358|Ga0126370_11674612 | Not Available | 611 | Open in IMG/M |
| 3300010359|Ga0126376_12854079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Sinorhizobium → Sinorhizobium meliloti | 533 | Open in IMG/M |
| 3300010360|Ga0126372_10208613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1635 | Open in IMG/M |
| 3300010360|Ga0126372_12339498 | Not Available | 584 | Open in IMG/M |
| 3300010360|Ga0126372_13245948 | Not Available | 506 | Open in IMG/M |
| 3300010361|Ga0126378_11787867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 699 | Open in IMG/M |
| 3300010361|Ga0126378_12774661 | Not Available | 559 | Open in IMG/M |
| 3300010362|Ga0126377_11033400 | Not Available | 889 | Open in IMG/M |
| 3300010362|Ga0126377_12498809 | Not Available | 592 | Open in IMG/M |
| 3300010362|Ga0126377_13334989 | Not Available | 519 | Open in IMG/M |
| 3300010366|Ga0126379_12795181 | Not Available | 584 | Open in IMG/M |
| 3300010366|Ga0126379_12895438 | Not Available | 574 | Open in IMG/M |
| 3300010398|Ga0126383_10095059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 2645 | Open in IMG/M |
| 3300010398|Ga0126383_10473914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1306 | Open in IMG/M |
| 3300010398|Ga0126383_11942130 | Not Available | 676 | Open in IMG/M |
| 3300010399|Ga0134127_11658477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium → Rhizobium sp. IBUN | 714 | Open in IMG/M |
| 3300012948|Ga0126375_10024695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2871 | Open in IMG/M |
| 3300012948|Ga0126375_10279166 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300012948|Ga0126375_10518071 | Not Available | 893 | Open in IMG/M |
| 3300012971|Ga0126369_10891162 | Not Available | 975 | Open in IMG/M |
| 3300012971|Ga0126369_12818054 | Not Available | 569 | Open in IMG/M |
| 3300013306|Ga0163162_11662733 | Not Available | 729 | Open in IMG/M |
| 3300016294|Ga0182041_12267655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. KLBC 81 | 508 | Open in IMG/M |
| 3300016319|Ga0182033_11999886 | Not Available | 528 | Open in IMG/M |
| 3300016319|Ga0182033_12181825 | Not Available | 505 | Open in IMG/M |
| 3300016357|Ga0182032_11041468 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 700 | Open in IMG/M |
| 3300016371|Ga0182034_11732283 | Not Available | 550 | Open in IMG/M |
| 3300016404|Ga0182037_10033781 | All Organisms → cellular organisms → Bacteria | 3281 | Open in IMG/M |
| 3300016404|Ga0182037_10685743 | Not Available | 876 | Open in IMG/M |
| 3300016404|Ga0182037_10815381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 805 | Open in IMG/M |
| 3300016445|Ga0182038_11972633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium → Rhizobium sp. IBUN | 528 | Open in IMG/M |
| 3300017947|Ga0187785_10404945 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300017970|Ga0187783_11260368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 533 | Open in IMG/M |
| 3300018060|Ga0187765_10302717 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300021478|Ga0210402_10924580 | Not Available | 799 | Open in IMG/M |
| 3300021560|Ga0126371_13152759 | Not Available | 558 | Open in IMG/M |
| 3300025929|Ga0207664_11386389 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300031543|Ga0318516_10360165 | Not Available | 839 | Open in IMG/M |
| 3300031668|Ga0318542_10232626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 935 | Open in IMG/M |
| 3300031679|Ga0318561_10591680 | Not Available | 611 | Open in IMG/M |
| 3300031682|Ga0318560_10324770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans | 830 | Open in IMG/M |
| 3300031724|Ga0318500_10220268 | Not Available | 914 | Open in IMG/M |
| 3300031740|Ga0307468_100586885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 906 | Open in IMG/M |
| 3300031744|Ga0306918_10696966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 795 | Open in IMG/M |
| 3300031744|Ga0306918_11559393 | Not Available | 504 | Open in IMG/M |
| 3300031747|Ga0318502_10863043 | Not Available | 550 | Open in IMG/M |
| 3300031833|Ga0310917_10912759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 591 | Open in IMG/M |
| 3300031845|Ga0318511_10479105 | Not Available | 575 | Open in IMG/M |
| 3300031946|Ga0310910_11480763 | Not Available | 521 | Open in IMG/M |
| 3300031947|Ga0310909_10089367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2457 | Open in IMG/M |
| 3300031947|Ga0310909_11465147 | Not Available | 545 | Open in IMG/M |
| 3300031954|Ga0306926_12063571 | Not Available | 639 | Open in IMG/M |
| 3300032001|Ga0306922_10618984 | Not Available | 1146 | Open in IMG/M |
| 3300032059|Ga0318533_10053128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2700 | Open in IMG/M |
| 3300032059|Ga0318533_10165241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1572 | Open in IMG/M |
| 3300032059|Ga0318533_10974673 | Not Available | 622 | Open in IMG/M |
| 3300032059|Ga0318533_11018240 | Not Available | 607 | Open in IMG/M |
| 3300032066|Ga0318514_10708772 | Not Available | 535 | Open in IMG/M |
| 3300032076|Ga0306924_10501032 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300032261|Ga0306920_100283846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2468 | Open in IMG/M |
| 3300032261|Ga0306920_103058716 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300033290|Ga0318519_10864511 | Not Available | 558 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 29.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 19.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_05224833 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MPSETSVVSGDPSIEELGCELAEAREQQAATARILAVISSSSSDPSRVLAEIAAS |
| JGI1027J11758_111759801 | 3300000789 | Soil | MPSEPSTVGGNKSVEELRCELAEARRREGATAEILRV |
| JGI1027J12803_1043602962 | 3300000955 | Soil | MPSEPSTVGGNKSVEELRCELAEARRREGATAEILRVISRSPTDL |
| Ga0066395_104361411 | 3300004633 | Tropical Forest Soil | MPSEVSTASGGQSVEALRQELAEAREQQAATAEVLRVISSSPM |
| Ga0066395_110252312 | 3300004633 | Tropical Forest Soil | MSSEVSTVTGEQSVEELRRELAERREQQAATAEILASISS |
| Ga0066388_1000140447 | 3300005332 | Tropical Forest Soil | MSPEASTMGGDQSVEELRCELAEARRELAEAQEQQTATAGILAALSSSPADL |
| Ga0066388_1011658433 | 3300005332 | Tropical Forest Soil | MPSEVSTIGGDQSLEELRRELTEAREQQAVTAAILTAISNSPIDSYRVFAE |
| Ga0066388_1017204552 | 3300005332 | Tropical Forest Soil | MPSDLSTATGELSVEALRRELAEARERELATAEILRVISS |
| Ga0066388_1060989932 | 3300005332 | Tropical Forest Soil | MD*VLPMTSDASTVTGDRSVEASRRELAEAREQQAATAEILATISSSVTDANQVFAKIAA |
| Ga0066388_1088480012 | 3300005332 | Tropical Forest Soil | MSTEASTTGDDRSVEELRRELTEAREQQAATAEILAAISSS |
| Ga0066905_1000922733 | 3300005713 | Tropical Forest Soil | MPSEASTVGGNHSAEELRRELTEAREQQAATAEILRVISSSSMDLQ |
| Ga0066905_1005021731 | 3300005713 | Tropical Forest Soil | MPSEVSTVAGDQSLEALRRELAEVREQQAATAEILASISSSVTDANQVFAKIAAS |
| Ga0066905_1018585281 | 3300005713 | Tropical Forest Soil | MPSQASVAGGDQSMEELKRELAEAREQQAATAGILAAISNSPADQSRVFAEIA |
| Ga0066905_1020022681 | 3300005713 | Tropical Forest Soil | MSHEASTVRGDQSVDELRRELAEAREQQAATAEILWVI |
| Ga0066905_1021797601 | 3300005713 | Tropical Forest Soil | MPSEVSTVGGDQSVEEVRRELAEAREQQAATAEILAAISNAPTDPSCV |
| Ga0066905_1022337932 | 3300005713 | Tropical Forest Soil | MSSEVSTVADDQSVEALRRELAEARQQQAATAEILASISSSVTDA |
| Ga0066903_1004264511 | 3300005764 | Tropical Forest Soil | MSSEVSTVTGEQSVEELRRELAELREQQAATAEILASISSSVTD |
| Ga0066903_1004386521 | 3300005764 | Tropical Forest Soil | MSREASTVGSDQSVEELKRELAESRDQQAATAEILRVISSSP |
| Ga0066903_1009511501 | 3300005764 | Tropical Forest Soil | MPSEVSTLGRGQSMEELRRELAEAREQLATTAGILAAISNSPTDAYRVFAE |
| Ga0066903_1009699851 | 3300005764 | Tropical Forest Soil | MSPEASTVGSDQSVEELKRELAESRDQQAATAEILRVISSSP |
| Ga0066903_1032595503 | 3300005764 | Tropical Forest Soil | MDWMETMPSKVSTVGGNQSVDELRRELAEAREQQAAT |
| Ga0066903_1033319691 | 3300005764 | Tropical Forest Soil | MSPEASTFGGEQSVEELRRELAEARGREAATSEILALISRSPMELQG |
| Ga0066903_1052083451 | 3300005764 | Tropical Forest Soil | MSPGASTIGGDQSVEDLRRELAEARAQQAATSEILRV |
| Ga0070716_1017319351 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPDTSSVSADQSVEELRRELAAAREQQAAASAVLRAISASRGD |
| Ga0079222_108133632 | 3300006755 | Agricultural Soil | MPSEVSTVTGEQSVEALRRELAEARVQQAATVEILASISSSVTDANQVF |
| Ga0066665_107429372 | 3300006796 | Soil | MPSEVSTVSGDQLVEGLRRELAEAREQQAATAEILAAISNSPTD |
| Ga0075424_1021952683 | 3300006904 | Populus Rhizosphere | MPSEVSTFRGDQSVEELRRELAEAWEQQTATADILRVIS |
| Ga0075424_1028309821 | 3300006904 | Populus Rhizosphere | MAPELTTVGGDQSLQELRRELAEAREQQATTAEIL |
| Ga0075418_103598773 | 3300009100 | Populus Rhizosphere | MPSAVATISGARSVEELKRELAEAREQQAATAEILRVISNSP |
| Ga0111538_108374552 | 3300009156 | Populus Rhizosphere | MPPEASTVSGDQLMEDLRRELAEAREQLTATAGILAAISNSPTGADRVFTEIAA |
| Ga0111538_139073242 | 3300009156 | Populus Rhizosphere | MAPEVSTVSGDQLVEELRRELADAPEQQAATAEILRVLSGSPMD |
| Ga0111538_141355191 | 3300009156 | Populus Rhizosphere | MPTEISTDRSDQSVQELRRELAEAREQQAASAEILRVIS |
| Ga0126374_110603792 | 3300009792 | Tropical Forest Soil | MPPELSTVHGDQSVEDLKRELAEAREQQAATAEILRVISSSP |
| Ga0126374_113439891 | 3300009792 | Tropical Forest Soil | MPSETSTACAGQSVEELRRELAEVREQQAATAGILAAMSNSPTDPFRAFADIA |
| Ga0126374_118103482 | 3300009792 | Tropical Forest Soil | MSPEASTIGGEQSVEELRRELAEARGREAATSEILALISRSPMELQGAFAEVAA |
| Ga0126384_101541832 | 3300010046 | Tropical Forest Soil | MPSEVSAATGDQSAEELRRELAGAREQQAATAEILAAISS |
| Ga0126384_109127582 | 3300010046 | Tropical Forest Soil | MPSETSTFCADQSVEELRHELAEARQQQAATAGILAAIPNSSGNPYRVLTDIAVSAASLCDSY |
| Ga0126382_100663501 | 3300010047 | Tropical Forest Soil | MPSDVSTVMGDRSVEALRHELAEARELQAATRAVLGAISNSPTDSARV |
| Ga0126382_101108225 | 3300010047 | Tropical Forest Soil | MPSETSVVSGDQSIEGLGRELAEAREQQAVTAEILAAISSSPSDPSRVFA |
| Ga0126382_107302081 | 3300010047 | Tropical Forest Soil | MPSEVSAVGGDQWVEELRRELAEAREQQAATAEIL |
| Ga0126382_116985372 | 3300010047 | Tropical Forest Soil | MPSEASVISGDQSIEELRRELAEAREQQAATAGIEFAH* |
| Ga0126382_120752891 | 3300010047 | Tropical Forest Soil | MSPEVSTVGGEQSVQELRRELAEAREQLAATAGILAAISN |
| Ga0126370_116746121 | 3300010358 | Tropical Forest Soil | MPSEVSTHSADQSVEELRRELADAREQQTATAEILRVISSL |
| Ga0126376_128540791 | 3300010359 | Tropical Forest Soil | MPSQVPTAFDHQSVEQLRRELAEAREQQAATAEMLRVISSSPMDLQR |
| Ga0126372_102086131 | 3300010360 | Tropical Forest Soil | MDWMETMPSKVSTVGGNQSVDELRRELAEAREQQAATTE |
| Ga0126372_123394981 | 3300010360 | Tropical Forest Soil | MQPEAAVVSGDQSMEELRRELAEARDQQAATSEILKVISSSPTD |
| Ga0126372_132459481 | 3300010360 | Tropical Forest Soil | MPSEVSTFSGDQSMEELVRELAEAREQQGATAEILRVI |
| Ga0126378_117878671 | 3300010361 | Tropical Forest Soil | MLPEASTIGGDQSAEQLSRELAEAREQQTATAEILR |
| Ga0126378_127746611 | 3300010361 | Tropical Forest Soil | MPSEVSTFSGDQSMEELVRELAEAREQQGATAEILRVISSSPMD |
| Ga0126377_110334002 | 3300010362 | Tropical Forest Soil | MSPNVSTLDGNQSADEFKRELAEAREQQAATAEILRVIS |
| Ga0126377_124988092 | 3300010362 | Tropical Forest Soil | MPSKVLTGAGDQSVEALRRELAEARAQQAATAEILASISSSVTDASQVF |
| Ga0126377_133349892 | 3300010362 | Tropical Forest Soil | MPPEVSTVSGDQSVEELRRALAEAQEQQAATAGILAAMSSSPTDPHRVFTDIAAS |
| Ga0126379_127951811 | 3300010366 | Tropical Forest Soil | MPSEGLIVSGDQSVEELRRDLADAREQQVATAEILRVIS |
| Ga0126379_128954382 | 3300010366 | Tropical Forest Soil | MSPEPSIIGGDQSVEELRRELAEAREHQAATAEILRVIS |
| Ga0126383_100950594 | 3300010398 | Tropical Forest Soil | MSPKASTLDGNQSADEFKRELAEAREQQAATAEILRVISNAP |
| Ga0126383_104739141 | 3300010398 | Tropical Forest Soil | MPSEVSTFRGDQSVEELRLELAEAREQQAATAAILAAIPNSPIDSYRV |
| Ga0126383_119421301 | 3300010398 | Tropical Forest Soil | MPSDTSTRCADQSVEELRRELAEAREQQTATAEILR |
| Ga0134127_116584771 | 3300010399 | Terrestrial Soil | MSSEVPTLGGNQSVRELRRELAEAREQQAATAEILAAISRSPTDLQGIFS |
| Ga0126375_100246951 | 3300012948 | Tropical Forest Soil | MPSKVSAVGGDHLVEELRRELAEAREQQAATAEILASISSSATD |
| Ga0126375_102791662 | 3300012948 | Tropical Forest Soil | MPSDVATGSGVQSVEDLRRDLAEAREQQAATAGILAAIPNSPTNAYGVFSKIAACAAQL |
| Ga0126375_105180712 | 3300012948 | Tropical Forest Soil | MPSETSTTSADQSVDELRRELAEAHEQQTATAEYNG |
| Ga0126369_108911621 | 3300012971 | Tropical Forest Soil | MPSEVPTVGGEQSFEELRRELAESREQQAATADILRV |
| Ga0126369_128180541 | 3300012971 | Tropical Forest Soil | MPSEVSTTSGAQLVEELRRELAEARERQAATAEILRVISS |
| Ga0163162_116627331 | 3300013306 | Switchgrass Rhizosphere | MPSEASTIGGDQSAEELRRELAQARRREAATAEVLRVISRSKTD |
| Ga0182041_122676551 | 3300016294 | Soil | MPSEVPTPSGDQSIEELRRELAEAREQQAATAGILAAISNSPTDPSRV |
| Ga0182033_119998861 | 3300016319 | Soil | MPSEVSAATGDQSAEELRRELAEAREQQAATAGILEAISNSPADLRRVLAEIA |
| Ga0182033_121818251 | 3300016319 | Soil | MPSAVSKVGDDQSVEKLERELAESRDQQVATAEILRVISSSSTDPERVFAE |
| Ga0182032_110414682 | 3300016357 | Soil | MPSEVSTVRGDQSVEELRRELAQALEQQAATAAILAV |
| Ga0182034_117322831 | 3300016371 | Soil | MSPGASTIGGDQSVEDLRRELAEAREQQAATSEILRVISSSP |
| Ga0182037_100337811 | 3300016404 | Soil | MPSETKTACADQSVEELRRELVEAREQQAATAGILAAISNSPTDPY |
| Ga0182037_106857432 | 3300016404 | Soil | MPSEVSTIGGDQSGEELRRELAEAREQQAATAEILAAVSNSPT |
| Ga0182037_108153812 | 3300016404 | Soil | MPPEVLTVSGDQSVEELGRELAEAREQQAATAEILQVISSSPILQRVFAVVA |
| Ga0182038_119726331 | 3300016445 | Soil | MPSEVSTIGGDQSVEEIRRELAEAREQQAATAEILAAISNSPTDPSRVFAQI |
| Ga0187785_104049452 | 3300017947 | Tropical Peatland | MPSEVSTVGGDQSVEELRRELAEARKQQAATAAILATLSNSS |
| Ga0187783_112603682 | 3300017970 | Tropical Peatland | MTGDQSVEELRRELTEAREQQAATAEILRVISSSRMDVERVF |
| Ga0187765_103027171 | 3300018060 | Tropical Peatland | MDAMSPEASTISGDQSVEELRRGLAEAREQQAATAEILRVI |
| Ga0210402_109245802 | 3300021478 | Soil | MPPEMSTVPGDRSVRDLECELTEAREQQAATHELLRVVGRA |
| Ga0126371_131527592 | 3300021560 | Tropical Forest Soil | MPSEVSTMSGGQSVEELRRELVEAREQQAATAEILQVIS |
| Ga0207664_113863892 | 3300025929 | Agricultural Soil | MPSETSTTSADQSVDELRRELAEAREQQTATAEIL |
| Ga0318516_103601651 | 3300031543 | Soil | MSPELSSIGGDQLVDELRHGLAEAREQQAATAEILAAISSSRTNP |
| Ga0318542_102326261 | 3300031668 | Soil | MPSETKTACADQSVEELRRELVEAREHQAATAGILAAISNSPTDPYRV |
| Ga0318561_105916802 | 3300031679 | Soil | MSPELSSIGGDQLVDELRHGLAEAREQQAATAEILATISSSR |
| Ga0318560_103247701 | 3300031682 | Soil | MPSEVSTIGGDQSGEKLRRELAEAREQQAATAEILAAISNSPTDPSRVFAEI |
| Ga0318500_102202682 | 3300031724 | Soil | MPPEVSTVSGDQSVEELRRELVAAREQQAVTAEILR |
| Ga0307468_1005868851 | 3300031740 | Hardwood Forest Soil | MPSEVSTGGGDQSAEELRRELAETRERQAATAGILAAISNSPTDAHRVFAEISASA |
| Ga0306918_106969661 | 3300031744 | Soil | MPSETKTACADQSVEELRRELVEAREQQAATAGILAAISNSPTDPYRVF |
| Ga0306918_115593931 | 3300031744 | Soil | LPPEMSTVSGDQSVEELRCELAEAREQQTATAEILRVISSSP |
| Ga0318502_108630431 | 3300031747 | Soil | MSPELSSIGGDQLVDELRHGLAEAREQQAATAEILAAISSSRTNPSSVFTSI |
| Ga0310917_109127592 | 3300031833 | Soil | MPSETKTACADQSVEELRRELVEAREQQAATAGILAAISNSPTD |
| Ga0318511_104791051 | 3300031845 | Soil | MSPGASTIGGDQSVEDLRRELAEAREQQGATAEILRVISC |
| Ga0310910_114807631 | 3300031946 | Soil | MLPEASTIGGDQSVEQLRRELAEAREQQAATAGILAAMSSS |
| Ga0310909_100893671 | 3300031947 | Soil | MLPEASTIGGDQSLEELRRELAEAREQQAATSEILRVISSSPM |
| Ga0310909_114651471 | 3300031947 | Soil | MSPELSSIGGDQLVDELRHGLAEAREQQAATAEILAAISSSRTNPSCVFTSIVASAA |
| Ga0306926_120635711 | 3300031954 | Soil | MPSQVPAAFDHRSVEQLRRQLAEAREQQIATAEILAAIS |
| Ga0306922_106189841 | 3300032001 | Soil | MPSEVSTVGDDQSVEVLRRELVAAREQQAATAEILRV |
| Ga0318533_100531281 | 3300032059 | Soil | MLPEASTIGGDQSVEQLRRELAEAREQQAATAGILAAMSSSPTDP |
| Ga0318533_101652411 | 3300032059 | Soil | MSSKASTLDGNQSTDEFKRELAAAREQQAATAEILR |
| Ga0318533_109746731 | 3300032059 | Soil | MSTVRDDQLMEELRRELADAREQQAATAEILEGISSSPTGFQRV |
| Ga0318533_110182401 | 3300032059 | Soil | MSPGASTIGGDQSVEDLRRELAEAREQQAATSEILRVISSSPKGSELV |
| Ga0318514_107087721 | 3300032066 | Soil | MPSKVSIVSGDQSVEELRRELVAAREQQAATAEIL |
| Ga0306924_105010321 | 3300032076 | Soil | MPSETRTACADQSVEELRRELVEAREQQAATAGILAAISNSPTDPY |
| Ga0306920_1002838461 | 3300032261 | Soil | MPSEVSTIGGDQSGEELRRELAEAREQQAATAEILA |
| Ga0306920_1030587162 | 3300032261 | Soil | MPSEVSTVRGDRSVEELERELAEAREQQAGILAAISNSPNDPHRVFADIAANAARLSDASNAGNFFR |
| Ga0318519_108645111 | 3300033290 | Soil | MSRVISTDGGDHSVEELRRELAEARAQQAATAEILRVISSSPMDLRSVFV |
| ⦗Top⦘ |