


| Basic Information | |
|---|---|
| Family ID | F097864 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 38 residues |
| Representative Sequence | TPGTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDA |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.96 % |
| % of genes near scaffold ends (potentially truncated) | 99.04 % |
| % of genes from short scaffolds (< 2000 bps) | 90.38 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.077 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (39.423 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.192 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.115 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 15.15% Coil/Unstructured: 84.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF13690 | CheX | 18.27 |
| PF01557 | FAA_hydrolase | 5.77 |
| PF00072 | Response_reg | 4.81 |
| PF01339 | CheB_methylest | 2.88 |
| PF03795 | YCII | 1.92 |
| PF01156 | IU_nuc_hydro | 1.92 |
| PF04509 | CheC | 1.92 |
| PF01039 | Carboxyl_trans | 1.92 |
| PF05593 | RHS_repeat | 0.96 |
| PF00682 | HMGL-like | 0.96 |
| PF01209 | Ubie_methyltran | 0.96 |
| PF00011 | HSP20 | 0.96 |
| PF01494 | FAD_binding_3 | 0.96 |
| PF02371 | Transposase_20 | 0.96 |
| PF03992 | ABM | 0.96 |
| PF03255 | ACCA | 0.96 |
| PF01344 | Kelch_1 | 0.96 |
| PF00069 | Pkinase | 0.96 |
| PF07883 | Cupin_2 | 0.96 |
| PF01584 | CheW | 0.96 |
| PF01797 | Y1_Tnp | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 5.77 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.85 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 2.88 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.92 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 1.92 |
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 1.92 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.92 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 1.92 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.96 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.96 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.96 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.96 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.96 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.96 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.96 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.08 % |
| Unclassified | root | N/A | 1.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101436659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1237 | Open in IMG/M |
| 3300000559|F14TC_103090663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300001162|JGI12714J13572_1009400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100776330 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300002917|JGI25616J43925_10012803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3699 | Open in IMG/M |
| 3300004092|Ga0062389_104528655 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005172|Ga0066683_10000696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 11639 | Open in IMG/M |
| 3300005330|Ga0070690_100991318 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300005526|Ga0073909_10726435 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005537|Ga0070730_10388673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300005537|Ga0070730_10424256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 859 | Open in IMG/M |
| 3300005552|Ga0066701_10176225 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300005598|Ga0066706_10617211 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300006046|Ga0066652_101023210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300006173|Ga0070716_101774286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300006176|Ga0070765_100967649 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300006755|Ga0079222_10444802 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300006797|Ga0066659_10317049 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300006954|Ga0079219_10308473 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300007258|Ga0099793_10276082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300007265|Ga0099794_10736736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300009088|Ga0099830_11098207 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300009088|Ga0099830_11396055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300009137|Ga0066709_103733940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300009545|Ga0105237_11478372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300009824|Ga0116219_10393156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300010043|Ga0126380_10511375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300010048|Ga0126373_12641437 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300010159|Ga0099796_10047059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1483 | Open in IMG/M |
| 3300010322|Ga0134084_10092658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 954 | Open in IMG/M |
| 3300010366|Ga0126379_12616245 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010398|Ga0126383_10471724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1308 | Open in IMG/M |
| 3300010398|Ga0126383_13129211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300011269|Ga0137392_11090913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300011270|Ga0137391_10349447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1270 | Open in IMG/M |
| 3300011270|Ga0137391_11236929 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300011271|Ga0137393_10172379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1816 | Open in IMG/M |
| 3300011271|Ga0137393_10735574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 844 | Open in IMG/M |
| 3300011271|Ga0137393_11129420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300011271|Ga0137393_11470963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300012096|Ga0137389_10447060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1106 | Open in IMG/M |
| 3300012189|Ga0137388_10879481 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300012189|Ga0137388_11904980 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300012202|Ga0137363_10058444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2791 | Open in IMG/M |
| 3300012203|Ga0137399_10222169 | All Organisms → cellular organisms → Bacteria | 1541 | Open in IMG/M |
| 3300012203|Ga0137399_11416510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300012205|Ga0137362_10307037 | Not Available | 1374 | Open in IMG/M |
| 3300012205|Ga0137362_10772775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300012205|Ga0137362_11793602 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300012206|Ga0137380_10686847 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300012206|Ga0137380_11001907 | Not Available | 714 | Open in IMG/M |
| 3300012207|Ga0137381_10061591 | All Organisms → cellular organisms → Bacteria | 3118 | Open in IMG/M |
| 3300012207|Ga0137381_10733459 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300012208|Ga0137376_10536285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1014 | Open in IMG/M |
| 3300012209|Ga0137379_10251653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1680 | Open in IMG/M |
| 3300012210|Ga0137378_11734922 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300012351|Ga0137386_10873599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 645 | Open in IMG/M |
| 3300012357|Ga0137384_10011462 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7202 | Open in IMG/M |
| 3300012359|Ga0137385_10377363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1211 | Open in IMG/M |
| 3300012361|Ga0137360_10196495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1630 | Open in IMG/M |
| 3300012361|Ga0137360_10220820 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300012683|Ga0137398_10070275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2132 | Open in IMG/M |
| 3300012683|Ga0137398_10714121 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012685|Ga0137397_11005053 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012918|Ga0137396_10699736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300012923|Ga0137359_10246880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1592 | Open in IMG/M |
| 3300012923|Ga0137359_10570599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
| 3300012924|Ga0137413_10771190 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300012976|Ga0134076_10475999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300013308|Ga0157375_12410686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300015356|Ga0134073_10008888 | All Organisms → cellular organisms → Bacteria | 2202 | Open in IMG/M |
| 3300015358|Ga0134089_10321842 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300018060|Ga0187765_11022819 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300020034|Ga0193753_10059177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2023 | Open in IMG/M |
| 3300020581|Ga0210399_10295380 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300021178|Ga0210408_10955036 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300021432|Ga0210384_11176143 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300021560|Ga0126371_11147655 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300022532|Ga0242655_10063929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 938 | Open in IMG/M |
| 3300025906|Ga0207699_10173885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1443 | Open in IMG/M |
| 3300025915|Ga0207693_10570755 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300025941|Ga0207711_11250560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300025961|Ga0207712_11142468 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300026309|Ga0209055_1139197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300026333|Ga0209158_1219556 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300026374|Ga0257146_1036182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
| 3300026532|Ga0209160_1272084 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300027587|Ga0209220_1176811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300027825|Ga0209039_10295763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300027826|Ga0209060_10426964 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300027875|Ga0209283_10584702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300031740|Ga0307468_101691481 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300031823|Ga0307478_10402529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1134 | Open in IMG/M |
| 3300031859|Ga0318527_10457039 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300031962|Ga0307479_10726660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 971 | Open in IMG/M |
| 3300032055|Ga0318575_10659902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300032180|Ga0307471_100011096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6073 | Open in IMG/M |
| 3300032180|Ga0307471_103175941 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300032829|Ga0335070_10017354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8349 | Open in IMG/M |
| 3300033289|Ga0310914_10312003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1419 | Open in IMG/M |
| 3300033290|Ga0318519_10561133 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300033402|Ga0326728_11003240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300033480|Ga0316620_10523617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1100 | Open in IMG/M |
| 3300034125|Ga0370484_0177881 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 39.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.77% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.85% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.96% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001162 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1014366591 | 3300000364 | Soil | PGSSAIFVPIRIVFSQSIPSAGLFRHGAAYLKPPE* |
| F14TC_1030906632 | 3300000559 | Soil | TPGSSAIFVPIRIVFSQAIPSAGLFRHGAAYLKPPE* |
| JGI12714J13572_10094001 | 3300001162 | Forest Soil | PGTGAIFVPIRIVFSQAIPSAGLHRHGAAYIKPPLDI* |
| JGIcombinedJ26739_1007763301 | 3300002245 | Forest Soil | SAAIFVPIRIVFSQAITSAGLYRHGAAYLRPPNEAGI* |
| JGI25616J43925_100128035 | 3300002917 | Grasslands Soil | PFTPGAGAIFVPIRIVFSQAIASAGLFRHGAAYIKPPVDGAD* |
| Ga0062389_1045286552 | 3300004092 | Bog Forest Soil | VPFTPGSSAIFVPIRIVFSQPIVSAGLFRHGAAYIKPPIDFGG* |
| Ga0066683_100006961 | 3300005172 | Soil | PFTPGTGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPSDN* |
| Ga0070690_1009913181 | 3300005330 | Switchgrass Rhizosphere | FTPGSAAIFVPIRVVFSQAIPTAGLYRHGAAYIKIPVDGGA* |
| Ga0073909_107264351 | 3300005526 | Surface Soil | YTPGTGAIFVPIRIVFSQHIPSAGLYRHGAAYLRPPD* |
| Ga0070730_103886733 | 3300005537 | Surface Soil | PGAGAIFVPIRIVFSQPIPSAGLFRHGAAYIKPPE* |
| Ga0070730_104242563 | 3300005537 | Surface Soil | IFVPIRIVFSQALPNIGLYRHGAAYVKPPVDGGA* |
| Ga0066701_101762251 | 3300005552 | Soil | TGAIFVPIRIVFSQAMPTAGLYRHGAAYIKPPLDT* |
| Ga0066706_106172111 | 3300005598 | Soil | VEVAVPFTPGTGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPIDK* |
| Ga0066652_1010232101 | 3300006046 | Soil | VAVPFTPGSGAIFVPIRIVFSQAIPSAGLHRHGAAYIKPPLDI* |
| Ga0070716_1017742862 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | FTPGSSAIFVPIRIVFSQAIPSAGLFRHGAAYLKPPG* |
| Ga0070765_1009676491 | 3300006176 | Soil | SGAIFVPIRIVFSQAIPSVGLYRHGAAYIRPASDSAD* |
| Ga0079222_104448022 | 3300006755 | Agricultural Soil | TPGTGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPIDN* |
| Ga0066659_103170494 | 3300006797 | Soil | PFTPGTGAIFVPIRIVFSQAIPSAGLHRHGAAYIKPPLDI* |
| Ga0079219_103084731 | 3300006954 | Agricultural Soil | GAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPMDN* |
| Ga0099793_102760822 | 3300007258 | Vadose Zone Soil | TPGSGAIFVPIRIVFSQAIPTAGLYRHGAAYVKPPLDI* |
| Ga0099794_107367362 | 3300007265 | Vadose Zone Soil | TPGAGAIFVPIRIVFSQALPAVGLYRHGAAYVKPPMDGA* |
| Ga0099830_110982071 | 3300009088 | Vadose Zone Soil | VLSTPGAGAIFVPIRIVFSQALPAVGLYRHGAAYVKPPMDGV* |
| Ga0099830_113960552 | 3300009088 | Vadose Zone Soil | AGAIFVPIRIVFSQGLPAVGLYRHGAAYVKPPTDGA* |
| Ga0066709_1037339402 | 3300009137 | Grasslands Soil | PGTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDV* |
| Ga0105237_114783722 | 3300009545 | Corn Rhizosphere | GSSAIFVPIRIVFSQSIPSAGLFRHGAAYLKPPE* |
| Ga0116219_103931561 | 3300009824 | Peatlands Soil | PGAGAIFVPIRIVFSQPIAKAGLFRHGAAYVRTPE* |
| Ga0126380_105113752 | 3300010043 | Tropical Forest Soil | PGTGAIFVPIRIVFSTPIASAGLFRHGAAYLRPPE* |
| Ga0126373_126414372 | 3300010048 | Tropical Forest Soil | YTPGAGAIFVPIRIVFSQPISTAGLFRHGAEYLRPPD* |
| Ga0099796_100470591 | 3300010159 | Vadose Zone Soil | PFTPGAGAIFVPIRIVFSEPIRSAGLFRHGAAYLKPPE* |
| Ga0134084_100926581 | 3300010322 | Grasslands Soil | GAIFVPIRIVFSQAIPSAGLHRHGAAYIKPPLDI* |
| Ga0126379_126162452 | 3300010366 | Tropical Forest Soil | GTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPIDN* |
| Ga0126383_104717241 | 3300010398 | Tropical Forest Soil | VPFTPGSSAIFVPIRIVFSQAIPSAGLFRHGAAYLKPPE* |
| Ga0126383_131292111 | 3300010398 | Tropical Forest Soil | VPYTAGTGTIFVPIRIIFSQDIPAAGLYRHGAAYIKPAFNT* |
| Ga0137392_110909131 | 3300011269 | Vadose Zone Soil | TPGTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDS* |
| Ga0137391_103494471 | 3300011270 | Vadose Zone Soil | TGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDA* |
| Ga0137391_112369292 | 3300011270 | Vadose Zone Soil | GAGAIFVPIRIVFSQALPAVGLYRHGAAYVKPPMDGA* |
| Ga0137393_101723791 | 3300011271 | Vadose Zone Soil | PGSGNIFVPVRIVFSQQIPAAGLYRHGASYIQQTSDRPE* |
| Ga0137393_107355741 | 3300011271 | Vadose Zone Soil | PFTPGAGAIFVPIRIVFSQPIPSAGLFRHGAAYIKPPVDAGD* |
| Ga0137393_111294202 | 3300011271 | Vadose Zone Soil | PGTGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPIDN* |
| Ga0137393_114709631 | 3300011271 | Vadose Zone Soil | GAIFVPIRIVFSQSIPTAGLYRHGAAYIKPPLDA* |
| Ga0137389_104470602 | 3300012096 | Vadose Zone Soil | PGTGAIFVPIRIVFSQAIPAVGLYRHGAAYIKPPLDA* |
| Ga0137388_108794811 | 3300012189 | Vadose Zone Soil | TGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPIDN* |
| Ga0137388_119049802 | 3300012189 | Vadose Zone Soil | GAIFVPIRIVFSQPIAAAGLFRHGAAYIKPPIDAGG* |
| Ga0137363_100584441 | 3300012202 | Vadose Zone Soil | GAGAIFVPIRIVFSQALPAVGLYRHGAAYVKPPGDGA* |
| Ga0137399_102221694 | 3300012203 | Vadose Zone Soil | AIFVPIRIVFSQAIPSAGLFRHGAAYIRPPVDGAD* |
| Ga0137399_114165101 | 3300012203 | Vadose Zone Soil | TPGSGAIFVPIRIVFSQAIPSAGLYRHGAAYLRAPE* |
| Ga0137362_103070371 | 3300012205 | Vadose Zone Soil | TPGSGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPLDT* |
| Ga0137362_107727751 | 3300012205 | Vadose Zone Soil | TGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPRDA* |
| Ga0137362_117936022 | 3300012205 | Vadose Zone Soil | FTPGAGAIFVPIRIVFSQALPTVGLYRHGAAYVKPPMDGV* |
| Ga0137380_106868472 | 3300012206 | Vadose Zone Soil | TGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPMDN* |
| Ga0137380_110019071 | 3300012206 | Vadose Zone Soil | TPGNSAIFVPIRIVSSRPIPTAGLFRHGAAYVSAPSD* |
| Ga0137381_100615911 | 3300012207 | Vadose Zone Soil | FTPGTGAIFVPIRIVFSQTIPTAGLYRHGAAYIKPPLDA* |
| Ga0137381_107334592 | 3300012207 | Vadose Zone Soil | AVPFTPGSGAIFVPIRIVFSQAIPSAGLHRHGAAYIKPPLDT* |
| Ga0137376_105362853 | 3300012208 | Vadose Zone Soil | AVPFTPGTGAIFVPIRIVFSQAIPSAGLHRHGAAYIKPPLDI* |
| Ga0137379_102516531 | 3300012209 | Vadose Zone Soil | GAIFVPIRIVFSQTIPTAGLYRHGAAYIKPPLDV* |
| Ga0137378_117349221 | 3300012210 | Vadose Zone Soil | NIFVPVRIVFSQQIPAAGLYRHGAAYIRLAPSDSE* |
| Ga0137386_108735992 | 3300012351 | Vadose Zone Soil | GTGAIFVPIRIVFSQTIPTAGLYRHGAAYIKPPLDV* |
| Ga0137384_100114621 | 3300012357 | Vadose Zone Soil | EVAVPFTPGTGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPLDA* |
| Ga0137385_103773631 | 3300012359 | Vadose Zone Soil | GTGAIFVPIRIVFSQTIPTAGLYRHGAAYIKPPLDA* |
| Ga0137360_101964953 | 3300012361 | Vadose Zone Soil | TPGTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDA* |
| Ga0137360_102208203 | 3300012361 | Vadose Zone Soil | PGTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDG* |
| Ga0137398_100702753 | 3300012683 | Vadose Zone Soil | GTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDA* |
| Ga0137398_107141211 | 3300012683 | Vadose Zone Soil | AVPFTPGAGAIFVPIRIVFSQGLPAVGLYRHGAAYVKPPMDGA* |
| Ga0137397_110050532 | 3300012685 | Vadose Zone Soil | FTPGAGAIFVPIRIVFSQGLPAVGLYRLGAAYVKPPMDGA* |
| Ga0137396_106997362 | 3300012918 | Vadose Zone Soil | TGAIFVPIRIVFSQSIPTAGLYRHGASYIKPPLDL* |
| Ga0137359_102468801 | 3300012923 | Vadose Zone Soil | TPGSGAIFVPIRIVFSQAIPTAGLHRHGAAYVKPPLDA* |
| Ga0137359_105705993 | 3300012923 | Vadose Zone Soil | VPFTPGSGAIFVPIRIVFSQPIPSAGLFRHGAAYLKPPE* |
| Ga0137413_107711901 | 3300012924 | Vadose Zone Soil | PGAGAIFVPIRIVFSQSIPTAGLYRHGAAYIKPPLDV* |
| Ga0134076_104759992 | 3300012976 | Grasslands Soil | PFTPGSGAIFVPIRIVFSQPIPSAGLFRHGAAYLKPPE* |
| Ga0157375_124106862 | 3300013308 | Miscanthus Rhizosphere | GNSAIFVPIRIVFSQAIPSAGLFRHGAAYLKPPV* |
| Ga0134073_100088883 | 3300015356 | Grasslands Soil | VPFTPGTGAIFVPIRIVFSQAIPTAGLHRHGAAYIKPPIDK* |
| Ga0134089_103218422 | 3300015358 | Grasslands Soil | PGTGAIFVPIRIVFSQAMPTAGLYRHGAAYIKPPLDT* |
| Ga0187765_110228192 | 3300018060 | Tropical Peatland | TPGSAAIFVPIRIVFSQAIAAAGLFRHGAAYIRPPGEGGD |
| Ga0193753_100591771 | 3300020034 | Soil | TPGSGAIFVPIRIVFSQAIPSAGLYRHGAAYLRPGIEPGS |
| Ga0210399_102953804 | 3300020581 | Soil | TPGSSAIFVPIRIVFSQAISSAGLYRHGAAYIRTAVDSGD |
| Ga0210408_109550363 | 3300021178 | Soil | VPFTPGAGAIFVPIRIVFSQALPAVGLYRHGAAYVKPPTEGA |
| Ga0210384_111761433 | 3300021432 | Soil | TPGAGAIFVPIRIVFSQALPAVGLYRHGAAYVKPPTEGA |
| Ga0126371_111476552 | 3300021560 | Tropical Forest Soil | VPFTPGTGAIFVPIRIVFSQAIPTAGLHRHGAAYVKPPIDN |
| Ga0242655_100639293 | 3300022532 | Soil | AVPFTPGSSAIFVPIRIVFSQPIPSAGLFRHGAAYIRTPVAAGD |
| Ga0207699_101738851 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TPGSGAIFVPVRIVFSVALPSAGLFKHGAAYVKALSGAGA |
| Ga0207693_105707551 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AVPFTPGAGAIFVPIRIVFSQPIRSAGLFRHGAAYLKPPE |
| Ga0207711_112505602 | 3300025941 | Switchgrass Rhizosphere | VPFTPGSSAIFVPIRIVFSQAIPSAGLFRHGAAYLKPPE |
| Ga0207712_111424682 | 3300025961 | Switchgrass Rhizosphere | AIFVPIRVVFSQAIPTAGLYRHGAAYIKIPVDGGA |
| Ga0209055_11391971 | 3300026309 | Soil | FTPGTGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDV |
| Ga0209158_12195562 | 3300026333 | Soil | PGSGNIFVPVRIVFSQQIPAAGLYRHGAAYIRLAPSDSE |
| Ga0257146_10361821 | 3300026374 | Soil | GSGAIFVPIRIVFSQAIPTAGLYRHGAAYVKPPLDA |
| Ga0209160_12720842 | 3300026532 | Soil | TGAIFVPIRIVFSQAIPTAGLYRHGAAYIKPPLDV |
| Ga0209220_11768112 | 3300027587 | Forest Soil | TGAIFVPIRIVFSQAIPTAGLYRHGASYIKPPLDA |
| Ga0209039_102957631 | 3300027825 | Bog Forest Soil | VPYTPGAGAIFVPIRIVSCQPIATAGLFRHGAAYVRTME |
| Ga0209060_104269641 | 3300027826 | Surface Soil | GSAAIFVPIRIVFSQAIPSAGLYRHGAAYLRPPNEAGA |
| Ga0209283_105847021 | 3300027875 | Vadose Zone Soil | GTGAIFVPIRIVFSQAIPAVGLYRHGAAYIKPPLDA |
| Ga0307468_1016914811 | 3300031740 | Hardwood Forest Soil | PGAGAIFVPIRIVFSQALPNVGLYRHGAAYVKANVDGGA |
| Ga0307478_104025293 | 3300031823 | Hardwood Forest Soil | PFTPGSSAIFVPIRIVFSQPIPSAGLFRHGASYLKPPE |
| Ga0318527_104570391 | 3300031859 | Soil | YTPGAGSIFVPIRIVFSQPISTAGLFRHGAAYLRPPD |
| Ga0307479_107266601 | 3300031962 | Hardwood Forest Soil | TPGTGAIFVPIRIVFSQSIPTAGLYRHGAAYIKPPLDA |
| Ga0318575_106599021 | 3300032055 | Soil | PGTGAIFVPIRIVFSQAIPTVGLHRHGAAYIKPPIDN |
| Ga0307471_1000110961 | 3300032180 | Hardwood Forest Soil | TPGSAAIFVPIRIVFSQAIPAAGLYRHGAAYIRPPVDSGA |
| Ga0307471_1031759411 | 3300032180 | Hardwood Forest Soil | AGAIFVPIRIVFSQAIPSAGLFRHGAAYIRPPVDAGD |
| Ga0335070_100173541 | 3300032829 | Soil | YTPGAGAIFVPIRIVFSQPIAAGLFRHGAAYLRPPE |
| Ga0310914_103120031 | 3300033289 | Soil | AVPFTPGAGAIFVPIRIVFSQPIASAGLFRHGASYLRPPE |
| Ga0318519_105611331 | 3300033290 | Soil | VPYTPGAGAIFVPIRIVFSQPISTAGLFRHGASYLRPPE |
| Ga0326728_110032401 | 3300033402 | Peat Soil | PGAGAIFVPIRIVFSQPIATAGLFRHGAAYVRPPE |
| Ga0316620_105236171 | 3300033480 | Soil | SGAIFVPIRIVFSQAIASAGLYRHGAAYIRPPMDSAD |
| Ga0370484_0177881_38_181 | 3300034125 | Untreated Peat Soil | VEVAVPFTPGSSAIFVPIRIVFSVPLPSAGLFKHGAAYIKSPNESGV |
| ⦗Top⦘ |