


| Basic Information | |
|---|---|
| Family ID | F097847 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MATEARELGDLISIGPAMLRDFELLGIRSVAQLAR |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.12 % |
| % of genes near scaffold ends (potentially truncated) | 99.04 % |
| % of genes from short scaffolds (< 2000 bps) | 89.42 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.115 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.308 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.808 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.038 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.57% β-sheet: 3.17% Coil/Unstructured: 68.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 8.65 |
| PF12681 | Glyoxalase_2 | 4.81 |
| PF11731 | Cdd1 | 4.81 |
| PF03992 | ABM | 2.88 |
| PF00551 | Formyl_trans_N | 2.88 |
| PF00579 | tRNA-synt_1b | 1.92 |
| PF03551 | PadR | 1.92 |
| PF03702 | AnmK | 1.92 |
| PF08238 | Sel1 | 0.96 |
| PF08239 | SH3_3 | 0.96 |
| PF13653 | GDPD_2 | 0.96 |
| PF03544 | TonB_C | 0.96 |
| PF05168 | HEPN | 0.96 |
| PF07238 | PilZ | 0.96 |
| PF00392 | GntR | 0.96 |
| PF08327 | AHSA1 | 0.96 |
| PF04389 | Peptidase_M28 | 0.96 |
| PF08448 | PAS_4 | 0.96 |
| PF00933 | Glyco_hydro_3 | 0.96 |
| PF08240 | ADH_N | 0.96 |
| PF08570 | DUF1761 | 0.96 |
| PF05960 | DUF885 | 0.96 |
| PF13188 | PAS_8 | 0.96 |
| PF12244 | DUF3606 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0162 | Tyrosyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.92 |
| COG0180 | Tryptophanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.92 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.92 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.92 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.92 |
| COG2377 | 1,6-Anhydro-N-acetylmuramate kinase | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.96 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.96 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.96 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.12 % |
| Unclassified | root | N/A | 2.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005434|Ga0070709_10043797 | All Organisms → cellular organisms → Bacteria | 2769 | Open in IMG/M |
| 3300005540|Ga0066697_10635967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
| 3300005577|Ga0068857_100687778 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300005617|Ga0068859_101515651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300005764|Ga0066903_107470948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 564 | Open in IMG/M |
| 3300005843|Ga0068860_100151530 | All Organisms → cellular organisms → Bacteria | 2233 | Open in IMG/M |
| 3300006041|Ga0075023_100588600 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300006174|Ga0075014_100386983 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300006755|Ga0079222_11962927 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300006796|Ga0066665_11515516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300006804|Ga0079221_11242909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 582 | Open in IMG/M |
| 3300006904|Ga0075424_100046545 | All Organisms → cellular organisms → Bacteria | 4524 | Open in IMG/M |
| 3300007255|Ga0099791_10445237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Chroococcidiopsidales → Chroococcidiopsidaceae → Chroococcidiopsis → unclassified Chroococcidiopsis → Chroococcidiopsis sp. CCMEE 29 | 626 | Open in IMG/M |
| 3300009038|Ga0099829_10278997 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300009088|Ga0099830_10109767 | All Organisms → cellular organisms → Bacteria | 2072 | Open in IMG/M |
| 3300009137|Ga0066709_101960664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300009162|Ga0075423_12857688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300010358|Ga0126370_11058097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300010360|Ga0126372_10054612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2733 | Open in IMG/M |
| 3300010360|Ga0126372_10292750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300010361|Ga0126378_10207274 | All Organisms → cellular organisms → Bacteria | 2039 | Open in IMG/M |
| 3300010361|Ga0126378_11708463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300010373|Ga0134128_13146958 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300010379|Ga0136449_102992838 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300011269|Ga0137392_10262138 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300012189|Ga0137388_10803295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300012359|Ga0137385_10296543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1392 | Open in IMG/M |
| 3300012363|Ga0137390_10486031 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300012582|Ga0137358_10482466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300012685|Ga0137397_10021227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4562 | Open in IMG/M |
| 3300012917|Ga0137395_10325787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1092 | Open in IMG/M |
| 3300012918|Ga0137396_11081364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300012971|Ga0126369_10490514 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300012982|Ga0168317_1090374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300014489|Ga0182018_10247019 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300014502|Ga0182021_12418141 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300014968|Ga0157379_11775651 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300015052|Ga0137411_1240668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300015053|Ga0137405_1100299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1085 | Open in IMG/M |
| 3300015241|Ga0137418_10858870 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300015264|Ga0137403_11556915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300015371|Ga0132258_11961530 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300017959|Ga0187779_10359680 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300017966|Ga0187776_10867624 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300018004|Ga0187865_1010424 | All Organisms → cellular organisms → Bacteria | 5162 | Open in IMG/M |
| 3300018004|Ga0187865_1014204 | All Organisms → cellular organisms → Bacteria | 4092 | Open in IMG/M |
| 3300018047|Ga0187859_10912371 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300018090|Ga0187770_10525524 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300019877|Ga0193722_1092216 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300020021|Ga0193726_1124247 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300020170|Ga0179594_10334398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300020581|Ga0210399_10151886 | All Organisms → cellular organisms → Bacteria | 1915 | Open in IMG/M |
| 3300020581|Ga0210399_10772931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300020581|Ga0210399_11143103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300020583|Ga0210401_11050903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300021178|Ga0210408_10193427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1617 | Open in IMG/M |
| 3300021401|Ga0210393_11108216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300021405|Ga0210387_10240865 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300021406|Ga0210386_11577169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Chroococcidiopsidales → Chroococcidiopsidaceae → Chroococcidiopsis → unclassified Chroococcidiopsis → Chroococcidiopsis sp. CCMEE 29 | 545 | Open in IMG/M |
| 3300021407|Ga0210383_11675514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300021420|Ga0210394_10216002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1674 | Open in IMG/M |
| 3300021420|Ga0210394_11620297 | Not Available | 544 | Open in IMG/M |
| 3300021433|Ga0210391_10810870 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300021476|Ga0187846_10166493 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300021479|Ga0210410_10579554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300021560|Ga0126371_13430550 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300021861|Ga0213853_10126128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 827 | Open in IMG/M |
| 3300022557|Ga0212123_10326429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1060 | Open in IMG/M |
| 3300022557|Ga0212123_10561786 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300024182|Ga0247669_1079761 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300024227|Ga0228598_1099017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300025906|Ga0207699_10044099 | All Organisms → cellular organisms → Bacteria | 2595 | Open in IMG/M |
| 3300025917|Ga0207660_11136905 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300025961|Ga0207712_10373588 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300026277|Ga0209350_1081151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
| 3300026310|Ga0209239_1209044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
| 3300026320|Ga0209131_1066141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1990 | Open in IMG/M |
| 3300026527|Ga0209059_1135329 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300027037|Ga0209005_1032257 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300027117|Ga0209732_1004072 | All Organisms → cellular organisms → Bacteria | 2401 | Open in IMG/M |
| 3300027729|Ga0209248_10026144 | All Organisms → cellular organisms → Bacteria | 1820 | Open in IMG/M |
| 3300027737|Ga0209038_10120987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300027768|Ga0209772_10141397 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300027842|Ga0209580_10137046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
| 3300027855|Ga0209693_10442334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300027903|Ga0209488_11028487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300027986|Ga0209168_10425553 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300028047|Ga0209526_10292143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1105 | Open in IMG/M |
| 3300028536|Ga0137415_10958724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300028906|Ga0308309_10552632 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300029943|Ga0311340_10391045 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300030503|Ga0311370_10770306 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300031231|Ga0170824_111029254 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300031708|Ga0310686_100246231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
| 3300031753|Ga0307477_10153119 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1608 | Open in IMG/M |
| 3300031833|Ga0310917_10882942 | Not Available | 602 | Open in IMG/M |
| 3300031946|Ga0310910_11427504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300031962|Ga0307479_11645677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300032180|Ga0307471_100902628 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300032180|Ga0307471_101268362 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300032805|Ga0335078_12378097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300032828|Ga0335080_11268282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300032892|Ga0335081_10517729 | Not Available | 1495 | Open in IMG/M |
| 3300032892|Ga0335081_11262418 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.85% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.88% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.88% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.92% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.96% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.96% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300027037 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070709_100437975 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTGVFMPVQQRRLEDLISVGPAMLRDFELLGIRSVKQLARQNP |
| Ga0066697_106359671 | 3300005540 | Soil | MATTTRQLADLISVGPAMLRDFEMLGIRSVSQLAK |
| Ga0068857_1006877783 | 3300005577 | Corn Rhizosphere | MPVQQRRLEDLISVGPAMIRDFELLRIRTVKQLAQRNPA |
| Ga0068859_1015156511 | 3300005617 | Switchgrass Rhizosphere | MKTQHRELKDLISVGPATLRDFERLGVRSVAKLATQN |
| Ga0066903_1074709482 | 3300005764 | Tropical Forest Soil | MASQARRLEDLVSVGPTMVRDLKLLGIHSVAQLSR |
| Ga0068860_1001515301 | 3300005843 | Switchgrass Rhizosphere | MPKEERRLEDLVSVGPAMLQDFELLGVESVSQLLRRSP |
| Ga0075023_1005886001 | 3300006041 | Watersheds | MTIPRRRLEDLISIGPAMLRDFEMLRIRSVTQLAKQN |
| Ga0075014_1003869831 | 3300006174 | Watersheds | MQTDQRKLRDLVSVGPAMLRDFELLGVRTVSQLARRNPE |
| Ga0079222_119629272 | 3300006755 | Agricultural Soil | MEAGSRELRDLVSIGPAMLRDLRILGIQSVDQLAKK |
| Ga0066665_115155161 | 3300006796 | Soil | MRTEERCLQDLVSIGPAMLRDLELLRIRSVAQLARKN |
| Ga0079221_112429092 | 3300006804 | Agricultural Soil | MVTTARQLGDLISIGPAMLRDFEMLGIRSVAQLAK |
| Ga0075424_1000465455 | 3300006904 | Populus Rhizosphere | MKTQRRELKDLISIGPAALRDFERLGIRSIAKLATQNPQS |
| Ga0099791_104452372 | 3300007255 | Vadose Zone Soil | MPSDSRKLSDLISVGPAMLRDFDILGVRSVAQLARRNP |
| Ga0099829_102789971 | 3300009038 | Vadose Zone Soil | MARAKRQLGDLISIGPAMLRDFELLGIRSVAQLAW |
| Ga0099830_101097671 | 3300009088 | Vadose Zone Soil | VSETRRQLGDLISIGPAMLRDFELLRIRSVAQLARQNP |
| Ga0066709_1019606643 | 3300009137 | Grasslands Soil | MQTETRQLKDLVSIGPAMLEDFELLGIRSVAQLRRRN |
| Ga0075423_128576882 | 3300009162 | Populus Rhizosphere | MPGETRQLRDLVSIGPAMLKDFELLGISSVAQLRR |
| Ga0126370_110580972 | 3300010358 | Tropical Forest Soil | MATPNRQLEDLISVGPAMVRDFKLLGIHSVGQLGR |
| Ga0126372_100546124 | 3300010360 | Tropical Forest Soil | MEAQARRLDDLVSVGPAMVRDFALLGIHSVAQLSRRN |
| Ga0126372_102927501 | 3300010360 | Tropical Forest Soil | MATATRQLGDLISVGPAMLRDFELLGIRSVTQLAK* |
| Ga0126378_102072744 | 3300010361 | Tropical Forest Soil | MITERRLADLVSVGPAMVRDFNLLGIHTVAQLSRRNPE |
| Ga0126378_117084632 | 3300010361 | Tropical Forest Soil | MATATRQLGDLISIGPAMLRDFHLLGIRSVAQLAKQ |
| Ga0134128_131469582 | 3300010373 | Terrestrial Soil | MGVFMPVQQRRLEDLISVGPAMLRDFELLGIRTVRQLA |
| Ga0136449_1029928382 | 3300010379 | Peatlands Soil | MATNERRLGDLVSVGPVMLKDFELLGIRSVAQLARQKP |
| Ga0137392_102621384 | 3300011269 | Vadose Zone Soil | MPSDPRKLSDLISVGLAMLRDFEILGVRSVSQLARRNPQ |
| Ga0137388_108032953 | 3300012189 | Vadose Zone Soil | MPADTRQLADLISVGPAMLLDFAILGVRSVAQLARQ |
| Ga0137385_102965434 | 3300012359 | Vadose Zone Soil | MATETRQLGDLISVGPAMLKDFEILGIRSVARLAEQN |
| Ga0137390_104860311 | 3300012363 | Vadose Zone Soil | MAKAARQLGDLISIGPAMLRDFELLGIRSVAQLARQNP |
| Ga0137358_104824661 | 3300012582 | Vadose Zone Soil | MKHQPRELKDLISMGPAMLREFETLGIRSVAQLAKQDP |
| Ga0137397_100212271 | 3300012685 | Vadose Zone Soil | VAKAARQLADLISIGPAMLRDFELLGIRSVAQLAR |
| Ga0137395_103257871 | 3300012917 | Vadose Zone Soil | MHRQRARQLGDLISIEPAMLRDFELLGIRSVAQLARQNPER |
| Ga0137396_110813641 | 3300012918 | Vadose Zone Soil | MARTTRHLGDLISIGPAMLRDFELLGIRSVAQLARKNP |
| Ga0126369_104905144 | 3300012971 | Tropical Forest Soil | MSREILIPIEKRRLEDLISVGPAILRDFELLGIRTMGGLARS |
| Ga0168317_10903742 | 3300012982 | Weathered Mine Tailings | MSTETRQLCGLISVGPAMLRDFEILGVRSVAQLAPV |
| Ga0182018_102470191 | 3300014489 | Palsa | MLVKEEFMQGHKRRLQDLISVGPAMLRDFELLGVGSMSQLA |
| Ga0182021_124181412 | 3300014502 | Fen | MTHKERRLEDLVSVGPAMLRDFELLGIRTIGQLARQKP |
| Ga0157379_117756512 | 3300014968 | Switchgrass Rhizosphere | MKTQRRELKDLISIGPATLRDFERLGIRSVAKLATQNPQ |
| Ga0137411_12406681 | 3300015052 | Vadose Zone Soil | MAEAARQLADLISIGPCCMLRDFELLKIRSVAQLARQ |
| Ga0137405_11002991 | 3300015053 | Vadose Zone Soil | MHGTVRQLGDLISVGPAMLRDFEQLGIRSVVQLARQH |
| Ga0137418_108588701 | 3300015241 | Vadose Zone Soil | MAKAARQLADLISIGPCMLRDFELLKIRSVAQLARQNP |
| Ga0137403_115569151 | 3300015264 | Vadose Zone Soil | MAKAARQLADLISIGPAMLRDFDLLGIRSVAQLAR |
| Ga0132258_119615303 | 3300015371 | Arabidopsis Rhizosphere | MLTKTRELKDLVSIGPAMLEDFELLGIHSVAQLKK |
| Ga0187779_103596803 | 3300017959 | Tropical Peatland | MASKPRRLADLDSIGPAMLRDFELLGIRSVAQLARQ |
| Ga0187776_108676242 | 3300017966 | Tropical Peatland | MPTQLMPTQERRLRDLISVGPAMVRDFELLGVRSVAQLARRN |
| Ga0187865_10104241 | 3300018004 | Peatland | MSMEERRLGDLVSIGPAMLRDFELLGIRTVKQLSRQKP |
| Ga0187865_10142043 | 3300018004 | Peatland | MASNRLLHDLISVGPAMLRDFDQLGIRSVPQLAKQDP |
| Ga0187859_109123712 | 3300018047 | Peatland | MAREERQLSDLVSIGPAMLRDFELLGVRTVAQLARRNP |
| Ga0187770_105255243 | 3300018090 | Tropical Peatland | MANHRQLADLVSIGPAMLRDFRLLGVRSVAQLARRS |
| Ga0193722_10922161 | 3300019877 | Soil | MKKDSRELKDLISIGPAMLRDFELLKIHTVEQLANQDP |
| Ga0193726_11242471 | 3300020021 | Soil | MATQVRRLEDLISVGPAMVRDFEMLGVRSIAQLAR |
| Ga0179594_103343982 | 3300020170 | Vadose Zone Soil | MAQAARQLADLISIGPAMLRDFDLLGIRSVAQLAR |
| Ga0210399_101518865 | 3300020581 | Soil | MAKKTRNLGDLISIGPAMLRDFQLLGIRSVAALGRQNP |
| Ga0210399_107729312 | 3300020581 | Soil | MTAKTKELGELMSIGPAMLRDFELLGIRSVEQLAQQD |
| Ga0210399_111431031 | 3300020581 | Soil | MAASTRKLADLISIGPAMLRDFELLGIPSVAQLAKQ |
| Ga0210401_110509032 | 3300020583 | Soil | MPAQTRELGDLISIGPAMLRDFGMMGIRSVAQLAKQ |
| Ga0210408_101934271 | 3300021178 | Soil | MPTPSQRQLKDLISIGPAMLRDFEQLGIKSVPQLARQKPF |
| Ga0210393_111082162 | 3300021401 | Soil | MAVQTRKLADLISVGPAMLRDFALLGIPSVAQLAKQ |
| Ga0210387_102408651 | 3300021405 | Soil | MTSKTRELGDLISIGPAMLKDFEMLGIRSVKELARK |
| Ga0210386_115771692 | 3300021406 | Soil | MPSDPRTLSELISVGPAMLRDFEILGVRSVAQLARRNP |
| Ga0210383_116755142 | 3300021407 | Soil | MAVEHRRLADLISVGPAMVRDFELLGVRSVAQLARRN |
| Ga0210394_102160024 | 3300021420 | Soil | MAVQTRKLADLISIGPAMLRDFELLGIPSVAELAKQD |
| Ga0210394_116202972 | 3300021420 | Soil | MTTDRQLRDLISVGPAIERNFHLLGIRSVVQLAKRDAH |
| Ga0210391_108108703 | 3300021433 | Soil | MPRDTRQLQDLISIGPAMLRDFELLGVRSVADLAR |
| Ga0187846_101664931 | 3300021476 | Biofilm | MATEPRRLADLISIGPAMLRDFDRLGIRSVTQLAR |
| Ga0210410_105795541 | 3300021479 | Soil | MARTTRQLGDLISIGPAMVRDFELLGIRSVAQVAR |
| Ga0126371_134305502 | 3300021560 | Tropical Forest Soil | MAVSQRRLEDLISVGTAMLRDFELLGIRSVQQLARQDPA |
| Ga0213853_101261281 | 3300021861 | Watersheds | MPVKERGLRDLISVGPAIAGDFELLGVRSVAQLSRSSP |
| Ga0212123_103264291 | 3300022557 | Iron-Sulfur Acid Spring | MHQDQRRLRDLVSVGPAMLRDFDLLGVRNVTQLAR |
| Ga0212123_105617861 | 3300022557 | Iron-Sulfur Acid Spring | MPHAPTRRLQDLISVGPAMLRDFDLLKVRSISQLARQDPRK |
| Ga0247669_10797612 | 3300024182 | Soil | MKAGVKAEKERELKDLISIGPAMLRDFELLGIRSVKQLAK |
| Ga0228598_10990172 | 3300024227 | Rhizosphere | MAKTSWQLAELISIGPAMLRDFELLGVRSVAQLARQNPKR |
| Ga0207699_100440995 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVQQRRLEDLISVGPAMLRDFELLGIRSVKQLAR |
| Ga0207660_111369052 | 3300025917 | Corn Rhizosphere | MPVQQRRLEDLISVGPAMLRDFELLGIRSVKQLARQNP |
| Ga0207712_103735883 | 3300025961 | Switchgrass Rhizosphere | MEASNRTLRDLVSIGPAMLRDLSALGIQSVEQLAK |
| Ga0209350_10811512 | 3300026277 | Grasslands Soil | MTTTARQLGDLISIGPAMLRDFELLRIRSIAHLGRRTPQRMYE |
| Ga0209239_12090441 | 3300026310 | Grasslands Soil | MATATRQLGDLVSVGPAMLRDFAILGIRSVARLAK |
| Ga0209131_10661411 | 3300026320 | Grasslands Soil | MGGTARQLGDLVSIGPAMLRDFEQLGIRNVAQLARQSPQ |
| Ga0209059_11353293 | 3300026527 | Soil | MPVQQHRLQDLISVGPAMLRDFELLGIRSVKHLARQ |
| Ga0209005_10322571 | 3300027037 | Forest Soil | MSVQERQLKNLISIGPASLRDFELLGIRSVKQLARQNP |
| Ga0209732_10040721 | 3300027117 | Forest Soil | MTGEERQLSDLLSIGPAMLCDFELLGVRTVAQLARRNPE |
| Ga0209248_100261444 | 3300027729 | Bog Forest Soil | MPSANRRLGDLVSIGPAMLRDFDLLGIRSVTQLARQNPEK |
| Ga0209038_101209873 | 3300027737 | Bog Forest Soil | MPAKTRKLADLISVGPAMLRDFELLGIRNITKLAKQD |
| Ga0209772_101413971 | 3300027768 | Bog Forest Soil | MQGHKRRLQDLISVGPAMLRDFELLGVGSMSQLAR |
| Ga0209580_101370461 | 3300027842 | Surface Soil | MATEARELGDLISIGPAMLRDFELLGIRSVAQLAR |
| Ga0209693_104423341 | 3300027855 | Soil | MHRVSTRRLQDLISVGPAMLRGFELLKVRSISQLA |
| Ga0209488_110284872 | 3300027903 | Vadose Zone Soil | MHKKERKEERKLMDLVSIGPAMLEDFELLGITSVIQLRRRSPQ |
| Ga0209168_104255532 | 3300027986 | Surface Soil | MPTEERKLQDLASIGPAMLRDFELLGIASVTQLSKRN |
| Ga0209526_102921432 | 3300028047 | Forest Soil | MAGEERQLSDLVSIGPAMLRDFELLGVRTVAQLARRNPE |
| Ga0137415_109587241 | 3300028536 | Vadose Zone Soil | MPQKPRRLKDLISIGPAMLRDFELLGIRSLAQLARQN |
| Ga0308309_105526323 | 3300028906 | Soil | MPHAPTRRLQDLISVGPAMLRDFELLKVRSISQLARQDPRK |
| Ga0311340_103910451 | 3300029943 | Palsa | MTREEQQLRDLVSIGPAMLRDFELLGVRTVAQLARRNP |
| Ga0311370_107703061 | 3300030503 | Palsa | MAGEERQLSDLGSIGPAMLRDFELLGVRTVAQLARRYPEKM |
| Ga0170824_1110292541 | 3300031231 | Forest Soil | MKKDSRELKDLISIGPAMLRDFQLLKIRTVQQLANQD |
| Ga0310686_1002462313 | 3300031708 | Soil | MLTEHRRLADLISVGPAMVRDFELLGVRSVAQLAR |
| Ga0307477_101531193 | 3300031753 | Hardwood Forest Soil | MPSDPRKLSDLISVGPAVLRDFEILGVRSVSQLARR |
| Ga0310917_108829421 | 3300031833 | Soil | MRSERRLQDLISIGPAMLRDFHLLGVQSVSQLAKQD |
| Ga0310910_114275042 | 3300031946 | Soil | MVTTPRQLNDLISIGPAMLRDFEILGIRSVAQLAK |
| Ga0307479_116456772 | 3300031962 | Hardwood Forest Soil | MATAARQLDDLISIGPAMLRDFELLGIHSVAQLARQN |
| Ga0307471_1009026283 | 3300032180 | Hardwood Forest Soil | MPTEERKLRDLVSIGPAMLRDFELLGVASVAQLSKRNPEK |
| Ga0307471_1012683621 | 3300032180 | Hardwood Forest Soil | MIGKECRLQDLISIGPALLRDFELLGVRSVTELAR |
| Ga0335078_123780971 | 3300032805 | Soil | MASTPHRLADLVSVGPAMLRDFELLGIRSVAQLAR |
| Ga0335080_112682821 | 3300032828 | Soil | MPGKTRQLGDLISIGPAMLRDFELLGIRSVAQLAKQ |
| Ga0335081_105177291 | 3300032892 | Soil | MSHRRHLGDLVSIGPAMLRDFQLLGVRSVAQLARR |
| Ga0335081_112624181 | 3300032892 | Soil | MATQERRLQDLISVGPAMVRDFRILGVRSVSALAR |
| ⦗Top⦘ |