


| Basic Information | |
|---|---|
| Family ID | F097799 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MAAQIRLPGRAEPLVIPEPGWAATYPPPSSRRVYAAAHVAAV |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 52.43 % |
| % of genes near scaffold ends (potentially truncated) | 98.08 % |
| % of genes from short scaffolds (< 2000 bps) | 87.50 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.654 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 8.57% Coil/Unstructured: 71.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF02894 | GFO_IDH_MocA_C | 22.12 |
| PF01408 | GFO_IDH_MocA | 5.77 |
| PF13377 | Peripla_BP_3 | 2.88 |
| PF01627 | Hpt | 0.96 |
| PF06187 | DUF993 | 0.96 |
| PF00532 | Peripla_BP_1 | 0.96 |
| PF02728 | Cu_amine_oxidN3 | 0.96 |
| PF12323 | HTH_OrfB_IS605 | 0.96 |
| PF13520 | AA_permease_2 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 22.12 |
| COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.50 % |
| Unclassified | root | N/A | 37.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10280059 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300001418|JGI20188J14859_1013941 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300001593|JGI12635J15846_10092549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2185 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100666888 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300005181|Ga0066678_10368805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 949 | Open in IMG/M |
| 3300005439|Ga0070711_100054905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2750 | Open in IMG/M |
| 3300005439|Ga0070711_101582323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300005537|Ga0070730_11029405 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005541|Ga0070733_10471521 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300005548|Ga0070665_102430601 | Not Available | 526 | Open in IMG/M |
| 3300005602|Ga0070762_11254129 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005610|Ga0070763_10081606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1600 | Open in IMG/M |
| 3300005610|Ga0070763_10689689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 598 | Open in IMG/M |
| 3300005764|Ga0066903_100909867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1593 | Open in IMG/M |
| 3300005921|Ga0070766_10445066 | Not Available | 855 | Open in IMG/M |
| 3300006175|Ga0070712_100650375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 896 | Open in IMG/M |
| 3300006176|Ga0070765_101286809 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300009089|Ga0099828_10204897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1761 | Open in IMG/M |
| 3300009089|Ga0099828_10230792 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
| 3300009792|Ga0126374_10007008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4138 | Open in IMG/M |
| 3300010358|Ga0126370_11034760 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300010360|Ga0126372_12442485 | Not Available | 573 | Open in IMG/M |
| 3300010366|Ga0126379_11348205 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300010376|Ga0126381_104946851 | Not Available | 511 | Open in IMG/M |
| 3300012206|Ga0137380_10620432 | Not Available | 944 | Open in IMG/M |
| 3300012929|Ga0137404_11095830 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300014654|Ga0181525_10385322 | Not Available | 769 | Open in IMG/M |
| 3300016319|Ga0182033_10488122 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300016387|Ga0182040_11951297 | Not Available | 504 | Open in IMG/M |
| 3300016422|Ga0182039_11938773 | Not Available | 541 | Open in IMG/M |
| 3300017822|Ga0187802_10003002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4857 | Open in IMG/M |
| 3300017823|Ga0187818_10025810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2516 | Open in IMG/M |
| 3300017933|Ga0187801_10023553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2113 | Open in IMG/M |
| 3300017970|Ga0187783_11298467 | Not Available | 524 | Open in IMG/M |
| 3300017973|Ga0187780_10345461 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300017975|Ga0187782_10725406 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300018060|Ga0187765_11359481 | Not Available | 505 | Open in IMG/M |
| 3300018482|Ga0066669_10061089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2440 | Open in IMG/M |
| 3300020581|Ga0210399_11576702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
| 3300021086|Ga0179596_10347097 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300021402|Ga0210385_11089701 | Not Available | 613 | Open in IMG/M |
| 3300021406|Ga0210386_10026967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4501 | Open in IMG/M |
| 3300021406|Ga0210386_10538612 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300021406|Ga0210386_11085163 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300021407|Ga0210383_11555781 | Not Available | 545 | Open in IMG/M |
| 3300022557|Ga0212123_10437898 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300025464|Ga0208076_1027687 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300025928|Ga0207700_10048043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3166 | Open in IMG/M |
| 3300026361|Ga0257176_1089006 | Not Available | 507 | Open in IMG/M |
| 3300027067|Ga0208602_1029441 | Not Available | 539 | Open in IMG/M |
| 3300027110|Ga0208488_1006060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2459 | Open in IMG/M |
| 3300027725|Ga0209178_1401298 | Not Available | 521 | Open in IMG/M |
| 3300027824|Ga0209040_10519129 | Not Available | 525 | Open in IMG/M |
| 3300027855|Ga0209693_10030320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2634 | Open in IMG/M |
| 3300027875|Ga0209283_10298766 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300027884|Ga0209275_10451115 | Not Available | 729 | Open in IMG/M |
| 3300027884|Ga0209275_10569028 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300028563|Ga0265319_1046943 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300028808|Ga0302228_10066655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1714 | Open in IMG/M |
| 3300028877|Ga0302235_10304191 | Not Available | 689 | Open in IMG/M |
| 3300030007|Ga0311338_11207893 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300030399|Ga0311353_11734823 | Not Available | 501 | Open in IMG/M |
| 3300030524|Ga0311357_10369068 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300030578|Ga0210275_10372452 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300030618|Ga0311354_10392993 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300031543|Ga0318516_10662773 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031544|Ga0318534_10136679 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
| 3300031544|Ga0318534_10325249 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300031544|Ga0318534_10632702 | Not Available | 607 | Open in IMG/M |
| 3300031546|Ga0318538_10262264 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300031546|Ga0318538_10727114 | Not Available | 538 | Open in IMG/M |
| 3300031715|Ga0307476_10657482 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300031736|Ga0318501_10754718 | Not Available | 538 | Open in IMG/M |
| 3300031744|Ga0306918_11178572 | Not Available | 592 | Open in IMG/M |
| 3300031764|Ga0318535_10443641 | Not Available | 578 | Open in IMG/M |
| 3300031769|Ga0318526_10126907 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300031771|Ga0318546_10478773 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300031781|Ga0318547_10587865 | Not Available | 690 | Open in IMG/M |
| 3300031796|Ga0318576_10580170 | Not Available | 528 | Open in IMG/M |
| 3300031823|Ga0307478_10223007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1524 | Open in IMG/M |
| 3300031835|Ga0318517_10213138 | Not Available | 871 | Open in IMG/M |
| 3300031846|Ga0318512_10512880 | Not Available | 608 | Open in IMG/M |
| 3300031879|Ga0306919_10657801 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300031890|Ga0306925_11815622 | Not Available | 583 | Open in IMG/M |
| 3300031893|Ga0318536_10077482 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
| 3300031945|Ga0310913_10151875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1601 | Open in IMG/M |
| 3300031946|Ga0310910_10441700 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300031947|Ga0310909_10201878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1653 | Open in IMG/M |
| 3300031947|Ga0310909_11686603 | Not Available | 501 | Open in IMG/M |
| 3300031954|Ga0306926_10619914 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300031954|Ga0306926_12425648 | Not Available | 577 | Open in IMG/M |
| 3300031962|Ga0307479_10858033 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300031962|Ga0307479_11926524 | Not Available | 541 | Open in IMG/M |
| 3300031981|Ga0318531_10473832 | Not Available | 567 | Open in IMG/M |
| 3300032043|Ga0318556_10564865 | Not Available | 594 | Open in IMG/M |
| 3300032044|Ga0318558_10423371 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300032044|Ga0318558_10572220 | Not Available | 564 | Open in IMG/M |
| 3300032044|Ga0318558_10593463 | Not Available | 553 | Open in IMG/M |
| 3300032054|Ga0318570_10582490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300032076|Ga0306924_11298125 | Not Available | 782 | Open in IMG/M |
| 3300032893|Ga0335069_12263834 | Not Available | 567 | Open in IMG/M |
| 3300032896|Ga0335075_10664200 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300033290|Ga0318519_10036413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2368 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.77% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.88% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.96% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001418 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300027067 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030578 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_102800591 | 3300001356 | Peatlands Soil | VQIRLPGRDGLFDIPSAGWAERYPPPTSRRVYAAAH |
| JGI20188J14859_10139411 | 3300001418 | Arctic Peat Soil | MGTLVRLPGRAQPVAIPDPPWAAGYPPPASRRVFAAAH |
| JGI12635J15846_100925493 | 3300001593 | Forest Soil | MTERISLPGRAEPLEIDPPGWAAGYPPPVSRRAYAA |
| JGIcombinedJ26739_1006668881 | 3300002245 | Forest Soil | MTARIRLPGRPDPLLIPAPSWAGCYSRPASRRVYAAAH |
| Ga0066678_103688051 | 3300005181 | Soil | MTALIRLPGRARPLVVPDPGWAAGYPAPVSRRVFAAAHVAAHRAAGGREA |
| Ga0070711_1000549053 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VTARIRLPGRPGPLDIPDPPWARSHPAPTSRRVFAAAHVAAFPDGSI |
| Ga0070711_1015823232 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAQIRLPGRAEPLVIPEPGWAATYPPPSSRRVYAAAHVAAV |
| Ga0070730_110294051 | 3300005537 | Surface Soil | VPAQIRLPGRDRPLVIPEPGWAGRYPPPRCRRVFAAAHVA |
| Ga0070733_104715211 | 3300005541 | Surface Soil | VTARISLPGRAEPLEVTGPAWAASYPPPASRRVYAAAHVASVDG |
| Ga0070665_1024306012 | 3300005548 | Switchgrass Rhizosphere | VTARIRLPGRPGPLDIPDPPWARSHPAPTSRRVFAAAH |
| Ga0070762_112541292 | 3300005602 | Soil | VSGTAQIRLPGHKEPLTVSAPGWAASYPPPASRRVY |
| Ga0070763_100816063 | 3300005610 | Soil | VAAQVQLPGRDEPLVIPEPGWAASYPPPVSRRVFAAAHVAAR |
| Ga0070763_106896892 | 3300005610 | Soil | VPSNGPAQILLPGRAPEAGPLVIPEPGWAAGYPPPTRRKVFAAAHVAASPSP |
| Ga0066903_1009098674 | 3300005764 | Tropical Forest Soil | MTVHIRLPGRAEPLAIPEPGWARRYLPPVSRRVYAAAHVAARPAADGKR |
| Ga0070766_104450661 | 3300005921 | Soil | MSELTAQLWLPGRSEPLIVPEPGWTACYPPPVSRRVYAAAHVA |
| Ga0070712_1006503751 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VVTARIRLPGRASPLAVPEPGWAAGYPPPRSRRVFAAAHVAAAPGPGG |
| Ga0070765_1012868092 | 3300006176 | Soil | MSAQILLPGRAEPLDVPDPGWAAGYPAPTRRSVYAAAHVA |
| Ga0099828_102048973 | 3300009089 | Vadose Zone Soil | VPAQIRLPGRDRPLVIPEPGWAGRYPPPRRRRVFAAAHVAAAPDGRVDW |
| Ga0099828_102307923 | 3300009089 | Vadose Zone Soil | MTARIRLPGRPDPLLIPAPSWAGCYSRPASRRVYAAAHVAA |
| Ga0126374_100070084 | 3300009792 | Tropical Forest Soil | MAAQIRLPGRAEPLVIPEPGWTATYPPPSSRRVYAAAHVAAAPVAARRGDIEID* |
| Ga0126370_110347601 | 3300010358 | Tropical Forest Soil | MTAQIRLPGRAEPLVIPAPGWAASHSPLTARRAYAAAHVAASPVAGR |
| Ga0126372_124424851 | 3300010360 | Tropical Forest Soil | MNTEIRLPGRAEPLLITEPGWARGYPPPVSRRVYAAAH |
| Ga0126379_113482051 | 3300010366 | Tropical Forest Soil | MTVTAQIRLPGRREPLRIADPGWDSREARGYPPPASRSVYAAAHV |
| Ga0126381_1049468511 | 3300010376 | Tropical Forest Soil | MAAQIRLPGRAEPLVVPEPGWAATYPPPSSRRVYAAAHVAAVPA |
| Ga0137380_106204322 | 3300012206 | Vadose Zone Soil | VPAEIRLPGRDRPLVIPEPGWADHYPPPRRRRVFAAAHVAAAPDGCVDWE |
| Ga0137404_110958301 | 3300012929 | Vadose Zone Soil | MAARIMLPGRAEPLEITPPGWAPGYPPPVSRRVYAAAHVA |
| Ga0181525_103853221 | 3300014654 | Bog | VAAQVWLPGRDEPLLIPEPGWAASYPPPASRRVFAAAHVAARPASGQPGAGRR |
| Ga0182033_104881222 | 3300016319 | Soil | VSALIRLPGRAAPLAVPEPGWAAGYPAPRSRRVFAAAHVAAAPGPDGRPV |
| Ga0182040_119512971 | 3300016387 | Soil | LAAQIRLPGRDRPSVIPEPGWAASYPPPRCRRVFAAAHVAASPDGAID |
| Ga0182039_119387731 | 3300016422 | Soil | MTAQIRLPGRAGPLTVPDPGWAEGYPAPVSRRVFAAAHVAAR |
| Ga0187802_100030021 | 3300017822 | Freshwater Sediment | VAVQIRLPGRDGLLEIPSPGWACCYPPPASRRVYAAAHIAARP |
| Ga0187818_100258101 | 3300017823 | Freshwater Sediment | VAVRIRLPGRDGLLEIPSPGWACCYPPPASRRVYAAAHVAAR |
| Ga0187801_100235531 | 3300017933 | Freshwater Sediment | VAVRIRLPGRDGLLEIPSPGWACCYPPPASRRVYAAAHVAA |
| Ga0187783_112984671 | 3300017970 | Tropical Peatland | VAAQIRLPGRAAPLDIPEPGWAASYPPPTSRRVYAAAHV |
| Ga0187780_103454611 | 3300017973 | Tropical Peatland | VNKQVQIALPGRPAPLVIPEPGWAAGYPPPVRRKVFAA |
| Ga0187782_107254061 | 3300017975 | Tropical Peatland | MTAQIRLPGRPGPLLIADPGWARGYPPPVSRSAYAAA |
| Ga0187765_113594812 | 3300018060 | Tropical Peatland | MTAQIRLPGRREPLLIPDPGWGSDGARGYPPPVSRSAY |
| Ga0066669_100610891 | 3300018482 | Grasslands Soil | MTALIRLPGRARPLVVPDPGWAAGYPAPVSRRVFAAAHV |
| Ga0210399_115767022 | 3300020581 | Soil | MTPRISLPGRAEPLEVAAPSWAPGYPPPASRRVYAAAHVASVDGGD |
| Ga0179596_103470972 | 3300021086 | Vadose Zone Soil | MTARIRLPGRPDPLLIPAPSWAGCYSRPASRRVYAAAHVAASPDG |
| Ga0210385_110897011 | 3300021402 | Soil | MKGDGATIRLPGRPEPLLVAEPPWERRYPPPVSRSVYAAAHVAATPD |
| Ga0210386_100269675 | 3300021406 | Soil | MAARIMLPGRAEPLEISSPGWAPGYRPPVSRRVYAAAHVA |
| Ga0210386_105386121 | 3300021406 | Soil | MAAGARILLPGRSEALTVTSPSWATSYPSPSSRRVYAAAHVAARSGG |
| Ga0210386_110851632 | 3300021406 | Soil | MGILVSLPGRAQPVAIPDPPWAAGYPPPASRSVFAA |
| Ga0210383_115557812 | 3300021407 | Soil | VPSNGTARIQLPGRVPGSGPLVIPKPGWAAGYPPPARRKVFAAAHV |
| Ga0212123_104378982 | 3300022557 | Iron-Sulfur Acid Spring | MLPGRAEPLDIPPPGWAPGYPPPASRRVYAAAHVASQ |
| Ga0208076_10276872 | 3300025464 | Arctic Peat Soil | MGARVSLPGRTQPVDIPDPPWAAGYPPPSSRRVYAAAHVAA |
| Ga0207700_100480433 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAAQIRLPGRAEPLVIPEPGWALSYPPPRSRRVYAAAHVAAAPVTAA |
| Ga0257176_10890061 | 3300026361 | Soil | VSAAIRLPGRREPLLIADPGWDRGYPPPVSRSVYAAAHVAARPSG |
| Ga0208602_10294412 | 3300027067 | Forest Soil | MTASIALPDRAAPLEITPPAWAAGYPPPVSRRVYAAAH |
| Ga0208488_10060601 | 3300027110 | Forest Soil | VQIRLPGRAEPVVVPEPGWAGCYPPPVSRRVYAAAH |
| Ga0209178_14012981 | 3300027725 | Agricultural Soil | VSARITLPGRAAPLDITAPTWAASYPPPASRRVYAAAH |
| Ga0209040_105191291 | 3300027824 | Bog Forest Soil | MSAQIVLPGRAEPLDVLEPGWAAGYPPPARRSVYAAAHVAANHDGS |
| Ga0209693_100303201 | 3300027855 | Soil | VSRQIQLPGRDEPLVIPEPGWAASYPPPVSRRVFAAAHVAARPGAARPG |
| Ga0209283_102987662 | 3300027875 | Vadose Zone Soil | MTARIRLPGRPDPLLIPAPSWAGCYSRPASRRVYA |
| Ga0209275_104511152 | 3300027884 | Soil | VSRQIQLPGRDEPLVIPEPGWAASYPPPVSRQVFAAAHVAARPASG |
| Ga0209275_105690281 | 3300027884 | Soil | MSAGISLPGRAAPLEIAPPGWAAAYPPPASRRVYAAAHVASVDS |
| Ga0265319_10469431 | 3300028563 | Rhizosphere | MTARISLPGRAEPLEVAAAAWAASYPPPTSRRAYAAAHVASVD |
| Ga0302228_100666551 | 3300028808 | Palsa | VAAQVLLPGRDEPLVIPEPGWETSYPPPVSRRVFAAAHVAARPGP |
| Ga0302235_103041911 | 3300028877 | Palsa | MSEVAAQVWLPGRDEPLVIPEPGWAASYPPPVSRRVFAAAH |
| Ga0311338_112078932 | 3300030007 | Palsa | VTAQIRLPGRAEPLLVADPAWAASYPPPASRRAYAA |
| Ga0311353_117348232 | 3300030399 | Palsa | MIRQIQLPGRDKPLVIPEPGWAASYPPPVSRRVFAAAHVAARPA |
| Ga0311357_103690682 | 3300030524 | Palsa | MTARIALPGRAEPLEITRPAWAGAYPPPASRRVYAAAH |
| Ga0210275_103724521 | 3300030578 | Soil | MTASIRLPGRPGLLEVPEPSWPAGHPAPRSRRVYAAPHVAA |
| Ga0311354_103929932 | 3300030618 | Palsa | VSARIALPGRAEPLEIAPPGWAAGYPPPASRRVYAA |
| Ga0318516_106627731 | 3300031543 | Soil | VTAQIRLPGRAEPLEIPEPGWASSYPPPSSRRVFAAAHVAAVS |
| Ga0318534_101366792 | 3300031544 | Soil | VPALIRLPGRDGPLVIPSPRWAAGYPAPARRKVFAAAHV |
| Ga0318534_103252492 | 3300031544 | Soil | VTVQIRLPGRPGPLAIPAPGWAPAYPPPASRRVFAAAHV |
| Ga0318534_106327021 | 3300031544 | Soil | MTAQIRLPGRAGPLTIPDPGWAERYPAPVSRRVFAAAHV |
| Ga0318538_102622642 | 3300031546 | Soil | MTAQIRLPGRREPLLIADPGWGSRGARGYPPPVSRSVYAAAH |
| Ga0318538_107271141 | 3300031546 | Soil | MTAQIRLPGRREPLLIADPGWARGYPPPVSRSVYAAAHVAAY |
| Ga0307476_106574821 | 3300031715 | Hardwood Forest Soil | VTAQIRLPGRVLGPLVIPEPGWAAGYPPPARRKVFAAAHVAASPSPAAGGGGD |
| Ga0318501_107547181 | 3300031736 | Soil | MQIQLPGRPTPLVVPAHGWAPAYPPPASRRVFAAAHVAA |
| Ga0306918_111785722 | 3300031744 | Soil | VSALIRLPGRAAPLAVPEPGWAAGYPAPRSRRVFAAAHVAAAPGPD |
| Ga0318535_104436412 | 3300031764 | Soil | VPALIRLPGRDGPLVIPSPRWAAGYPAPARRKVFAAAHVAAK |
| Ga0318526_101269072 | 3300031769 | Soil | MSEVAVQIRLPGRAEPLVIPEPGWAVSYPPPASRRVYAAAHVAAAPGAGAGA |
| Ga0318546_104787731 | 3300031771 | Soil | VTAQIRLPGRAEPLEIPEPGWASSYLPPSSRRVFAAGQPD |
| Ga0318547_105878652 | 3300031781 | Soil | MAAQIRLPGRAEPLEIPEPGWASSYPPPSSRRVFAAAHVAAVS |
| Ga0318576_105801701 | 3300031796 | Soil | MTAEIRLPGRREPLLIADPGWDSRGARGYPPPVSRSVYA |
| Ga0307478_102230073 | 3300031823 | Hardwood Forest Soil | MSAAVSLPGRQAPFEITRPAWAAGYPPPVSRRVFAAAHV |
| Ga0318517_102131382 | 3300031835 | Soil | MPEMTVQIRLPGRPGPLAVPAPGWAPAYPSPSSRRV |
| Ga0318512_105128801 | 3300031846 | Soil | MTAQIRLPGRREPLLIADPGWGSRGARGYPPPVTRSVYAAAHVAAYT |
| Ga0306919_106578011 | 3300031879 | Soil | MAAQIRLPGRAEPLVIPEPEWAATYPPPSSRRVYAAAHVAAAPVVTH |
| Ga0306925_118156222 | 3300031890 | Soil | VAAQIRLPGRAEPLVVPEPGWAASYPPPLSRRVYAAAHVAAAPVAAHRAAA |
| Ga0318536_100774821 | 3300031893 | Soil | MAAQIRLPGRAEPLVIPEPGWAATYPPPSSRRVYAAAHVAAGVGIGID |
| Ga0318520_102087662 | 3300031897 | Soil | VQIQLPGRAGPLVIPAPPWAPGYRPPTSRRVWAAAHVAAVGG |
| Ga0310913_101518753 | 3300031945 | Soil | MTVQIRLPGRPGPLAVPAPGWAPAYPPPASRRVFAAA |
| Ga0310910_104417001 | 3300031946 | Soil | MTAQIRMPGRAGPLTVPDPGWAEGYPAPVSRRVFAAAHVAAR |
| Ga0310909_102018783 | 3300031947 | Soil | VSALIRLPGRAAPLAVPEPGWAAGYPAPRSRRVFAAAHVAAAPG |
| Ga0310909_116866032 | 3300031947 | Soil | MTAQIRLPGRREPLLIADPGWGSRGARGYPPPVTRSVYA |
| Ga0306926_106199142 | 3300031954 | Soil | LTAQIWLPGRDARSGPLVILEPGWAACYRPPACRRVYAAAHVAASPGSDGEVID |
| Ga0306926_124256482 | 3300031954 | Soil | VTAQVWLPGRTEPFVIPEPDWAARYPPPAFRRVYAAAH |
| Ga0307479_108580331 | 3300031962 | Hardwood Forest Soil | MAVQIRLPGRAELLEIPSPDWALRYPPPTSRRVYAAAHVAARPGPVGEVI |
| Ga0307479_119265242 | 3300031962 | Hardwood Forest Soil | VAAQMRLPGRAEPLEINDPGWAASYPPPASRRVFAAAHVAATPDV |
| Ga0318531_104738321 | 3300031981 | Soil | VSALIRLPGRAAPLAVPEPGWAAGYPAPRSRRVFAAA |
| Ga0318556_105648652 | 3300032043 | Soil | VTAQVWLPGRTEPFVIPEPDWAARYPPPAFRRVYAAAHVAASPGRD |
| Ga0318558_104233711 | 3300032044 | Soil | MTAQIRLPGRREPLLIADPGWGSRGARGYPPPVTRSVYAAAHVAARPG |
| Ga0318558_105722202 | 3300032044 | Soil | VQIRLPGRPGPLAVPAPGWAPAYPPPASRRVFAAA |
| Ga0318558_105934632 | 3300032044 | Soil | MTAQIRLPGRREPLLIADPGWGSHGARGYPPPVSRSAYAAAHV |
| Ga0318570_105824902 | 3300032054 | Soil | MPEMTVQIRLPGRPGPLAVPAPGWAPAYPSPASRRVFAAAHVAAVG |
| Ga0306924_112981251 | 3300032076 | Soil | MPKVAAAIQLPGRAGPLVISPPPWAPGYPPPASRRVWAAA |
| Ga0335069_122638341 | 3300032893 | Soil | MTATIVLPGRAEPLEITAPGWAAGYPQPVSRRVYAAAHV |
| Ga0335075_106642002 | 3300032896 | Soil | VAATIRLPGRDQPLVIPAPGWARSYPPPSLRRVYAAAHVAALDADTVDWD |
| Ga0318519_100364131 | 3300033290 | Soil | MTVQIRLPGRPGPLAVPAPGWAPAYPSPASRRVFAAAHVAAVGG |
| ⦗Top⦘ |