


| Basic Information | |
|---|---|
| Family ID | F097756 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 48 residues |
| Representative Sequence | GCAFAHIPTGTTANHRIDIDEGEDRSNVMSVAPSAIGAGTEIGRATP |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.85 % |
| % of genes near scaffold ends (potentially truncated) | 96.15 % |
| % of genes from short scaffolds (< 2000 bps) | 92.31 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.962 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (36.538 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.231 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (54.808 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00535 | Glycos_transf_2 | 2.88 |
| PF00072 | Response_reg | 1.92 |
| PF00106 | adh_short | 1.92 |
| PF13439 | Glyco_transf_4 | 1.92 |
| PF05598 | DUF772 | 1.92 |
| PF13701 | DDE_Tnp_1_4 | 1.92 |
| PF02371 | Transposase_20 | 1.92 |
| PF13358 | DDE_3 | 1.92 |
| PF13683 | rve_3 | 1.92 |
| PF03976 | PPK2 | 0.96 |
| PF04392 | ABC_sub_bind | 0.96 |
| PF02397 | Bac_transf | 0.96 |
| PF14319 | Zn_Tnp_IS91 | 0.96 |
| PF02646 | RmuC | 0.96 |
| PF13565 | HTH_32 | 0.96 |
| PF00011 | HSP20 | 0.96 |
| PF05050 | Methyltransf_21 | 0.96 |
| PF04986 | Y2_Tnp | 0.96 |
| PF07238 | PilZ | 0.96 |
| PF01361 | Tautomerase | 0.96 |
| PF01471 | PG_binding_1 | 0.96 |
| PF00589 | Phage_integrase | 0.96 |
| PF09490 | CbtA | 0.96 |
| PF04240 | Caroten_synth | 0.96 |
| PF13614 | AAA_31 | 0.96 |
| PF01755 | Glyco_transf_25 | 0.96 |
| PF00296 | Bac_luciferase | 0.96 |
| PF04909 | Amidohydro_2 | 0.96 |
| PF04828 | GFA | 0.96 |
| PF00166 | Cpn10 | 0.96 |
| PF14534 | DUF4440 | 0.96 |
| PF00512 | HisKA | 0.96 |
| PF07883 | Cupin_2 | 0.96 |
| PF01548 | DEDD_Tnp_IS110 | 0.96 |
| PF13340 | DUF4096 | 0.96 |
| PF03592 | Terminase_2 | 0.96 |
| PF07366 | SnoaL | 0.96 |
| PF13495 | Phage_int_SAM_4 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.88 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.96 |
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.96 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.96 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG2324 | Uncharacterized membrane protein | Function unknown [S] | 0.96 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.96 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.96 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.96 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.96 % |
| All Organisms | root | All Organisms | 49.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FHA1B5K04YM2WS | Not Available | 521 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100961401 | Not Available | 738 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101135959 | Not Available | 669 | Open in IMG/M |
| 3300004009|Ga0055437_10139015 | Not Available | 745 | Open in IMG/M |
| 3300005330|Ga0070690_100782917 | Not Available | 739 | Open in IMG/M |
| 3300005332|Ga0066388_108722220 | Not Available | 504 | Open in IMG/M |
| 3300005355|Ga0070671_100241490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1533 | Open in IMG/M |
| 3300005355|Ga0070671_101777175 | Not Available | 548 | Open in IMG/M |
| 3300005364|Ga0070673_100604314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1001 | Open in IMG/M |
| 3300005445|Ga0070708_101804853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300005518|Ga0070699_101195422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 697 | Open in IMG/M |
| 3300005561|Ga0066699_10807369 | Not Available | 660 | Open in IMG/M |
| 3300005615|Ga0070702_101427538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300005615|Ga0070702_101433572 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005764|Ga0066903_106117300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300005937|Ga0081455_10204924 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300006031|Ga0066651_10022208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Nitrospirillum → Nitrospirillum amazonense | 2749 | Open in IMG/M |
| 3300006175|Ga0070712_101811528 | Not Available | 534 | Open in IMG/M |
| 3300007982|Ga0102924_1215316 | Not Available | 820 | Open in IMG/M |
| 3300009038|Ga0099829_10088424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2387 | Open in IMG/M |
| 3300009088|Ga0099830_11202561 | Not Available | 629 | Open in IMG/M |
| 3300009088|Ga0099830_11740934 | Not Available | 520 | Open in IMG/M |
| 3300009089|Ga0099828_10709724 | Not Available | 903 | Open in IMG/M |
| 3300009089|Ga0099828_10866167 | Not Available | 808 | Open in IMG/M |
| 3300009089|Ga0099828_11406721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300009090|Ga0099827_10096501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2342 | Open in IMG/M |
| 3300009090|Ga0099827_11449070 | Not Available | 598 | Open in IMG/M |
| 3300009098|Ga0105245_12246582 | Not Available | 599 | Open in IMG/M |
| 3300009101|Ga0105247_10317134 | Not Available | 1086 | Open in IMG/M |
| 3300009143|Ga0099792_10641631 | Not Available | 681 | Open in IMG/M |
| 3300009143|Ga0099792_10946514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
| 3300010046|Ga0126384_11561579 | Not Available | 620 | Open in IMG/M |
| 3300010154|Ga0127503_11207265 | Not Available | 533 | Open in IMG/M |
| 3300010376|Ga0126381_102820460 | Not Available | 693 | Open in IMG/M |
| 3300010376|Ga0126381_104079378 | Not Available | 568 | Open in IMG/M |
| 3300010376|Ga0126381_104862590 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010379|Ga0136449_101822218 | Not Available | 909 | Open in IMG/M |
| 3300011120|Ga0150983_10323821 | Not Available | 533 | Open in IMG/M |
| 3300011269|Ga0137392_10533023 | Not Available | 975 | Open in IMG/M |
| 3300011269|Ga0137392_10610949 | Not Available | 905 | Open in IMG/M |
| 3300011270|Ga0137391_10067773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium | 3061 | Open in IMG/M |
| 3300011270|Ga0137391_10692331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300011271|Ga0137393_10070885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2780 | Open in IMG/M |
| 3300012096|Ga0137389_10786527 | Not Available | 817 | Open in IMG/M |
| 3300012204|Ga0137374_10298104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1324 | Open in IMG/M |
| 3300012205|Ga0137362_11175483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 651 | Open in IMG/M |
| 3300012207|Ga0137381_10210208 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
| 3300012208|Ga0137376_11542348 | Not Available | 555 | Open in IMG/M |
| 3300012209|Ga0137379_10413176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1258 | Open in IMG/M |
| 3300012210|Ga0137378_10516759 | Not Available | 1102 | Open in IMG/M |
| 3300012211|Ga0137377_11559725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 585 | Open in IMG/M |
| 3300012211|Ga0137377_11612715 | Not Available | 572 | Open in IMG/M |
| 3300012354|Ga0137366_10142535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1805 | Open in IMG/M |
| 3300012357|Ga0137384_11149293 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300012359|Ga0137385_10367326 | Not Available | 1230 | Open in IMG/M |
| 3300012359|Ga0137385_10963923 | Not Available | 704 | Open in IMG/M |
| 3300012361|Ga0137360_10922346 | Not Available | 753 | Open in IMG/M |
| 3300012362|Ga0137361_10670621 | Not Available | 948 | Open in IMG/M |
| 3300012363|Ga0137390_10333010 | Not Available | 1499 | Open in IMG/M |
| 3300012363|Ga0137390_10632036 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
| 3300012363|Ga0137390_10791858 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300012363|Ga0137390_10939364 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300012469|Ga0150984_104673928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. 1G10 | 2250 | Open in IMG/M |
| 3300012683|Ga0137398_10157021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1480 | Open in IMG/M |
| 3300012923|Ga0137359_11171673 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300012930|Ga0137407_10897036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 838 | Open in IMG/M |
| 3300014969|Ga0157376_11709276 | Not Available | 665 | Open in IMG/M |
| 3300015357|Ga0134072_10083986 | Not Available | 951 | Open in IMG/M |
| 3300015372|Ga0132256_100521704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1299 | Open in IMG/M |
| 3300015373|Ga0132257_103594073 | Not Available | 564 | Open in IMG/M |
| 3300015374|Ga0132255_101427848 | Not Available | 1046 | Open in IMG/M |
| 3300016357|Ga0182032_11578216 | Not Available | 571 | Open in IMG/M |
| 3300017930|Ga0187825_10151082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 821 | Open in IMG/M |
| 3300018468|Ga0066662_11128697 | Not Available | 786 | Open in IMG/M |
| 3300018482|Ga0066669_10862153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 807 | Open in IMG/M |
| 3300020582|Ga0210395_10257406 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300020582|Ga0210395_10338975 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300021171|Ga0210405_10088845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2436 | Open in IMG/M |
| 3300021401|Ga0210393_11021584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 669 | Open in IMG/M |
| 3300021403|Ga0210397_11436871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 536 | Open in IMG/M |
| 3300021432|Ga0210384_10510946 | Not Available | 1081 | Open in IMG/M |
| 3300021476|Ga0187846_10479483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 509 | Open in IMG/M |
| 3300021560|Ga0126371_11039445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 960 | Open in IMG/M |
| 3300021560|Ga0126371_13700965 | Not Available | 516 | Open in IMG/M |
| 3300025569|Ga0210073_1009465 | Not Available | 1869 | Open in IMG/M |
| 3300025931|Ga0207644_10538962 | Not Available | 965 | Open in IMG/M |
| 3300025941|Ga0207711_11349804 | Not Available | 655 | Open in IMG/M |
| 3300027535|Ga0209734_1007608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1938 | Open in IMG/M |
| 3300027610|Ga0209528_1043293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 997 | Open in IMG/M |
| 3300027616|Ga0209106_1046103 | Not Available | 971 | Open in IMG/M |
| 3300027645|Ga0209117_1047196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1287 | Open in IMG/M |
| 3300027651|Ga0209217_1035235 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300027655|Ga0209388_1107972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 797 | Open in IMG/M |
| 3300027738|Ga0208989_10045371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1525 | Open in IMG/M |
| 3300031058|Ga0308189_10321967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 612 | Open in IMG/M |
| 3300031122|Ga0170822_16093474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
| 3300031474|Ga0170818_102648410 | Not Available | 706 | Open in IMG/M |
| 3300031708|Ga0310686_103621353 | Not Available | 506 | Open in IMG/M |
| 3300031708|Ga0310686_113259203 | All Organisms → cellular organisms → Bacteria | 2095 | Open in IMG/M |
| 3300031912|Ga0306921_12436316 | Not Available | 545 | Open in IMG/M |
| 3300031947|Ga0310909_11636059 | Not Available | 510 | Open in IMG/M |
| 3300032028|Ga0316052_103700 | Not Available | 831 | Open in IMG/M |
| 3300032035|Ga0310911_10170194 | Not Available | 1232 | Open in IMG/M |
| 3300032261|Ga0306920_101189044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1102 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 36.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.96% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.96% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.96% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.96% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025569 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032028 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSA5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_00265460 | 2070309004 | Green-Waste Compost | TGTTANHRIGIDEGEGRSNVISVAPSAIGAGTEIGRATP |
| JGIcombinedJ26739_1009614012 | 3300002245 | Forest Soil | ECPWICGRSASPTGCAFAHIPTGTTANHRIDIDEGEGRSNVMSVAPSAIAAGTEIGRATP |
| JGIcombinedJ26739_1011359591 | 3300002245 | Forest Soil | TGGAFAPHIPTGTTANHRIDVDEGGGKSDVMTVALGAIGAGTEIGRATP* |
| Ga0055437_101390151 | 3300004009 | Natural And Restored Wetlands | TGTTANHRIDIDEKANRSDAMTVAPGAIGAGIEIGRVTP* |
| Ga0070690_1007829171 | 3300005330 | Switchgrass Rhizosphere | PWICGRSASPTGCAFAHIPTGTTANNRIDVDEEEDSSDVMTVAPGAIGAGTEIGRATP* |
| Ga0066388_1087222201 | 3300005332 | Tropical Forest Soil | PTGCAFAHIPTGTTANHRIDVDEEDDRSDVMTVALRAIGAGSKLGRATP* |
| Ga0070671_1002414905 | 3300005355 | Switchgrass Rhizosphere | ICGRSALPTGCAFAHIPTGTTANHRIDVDEAEDRSVAMTVAPGGTGAGTEIGRATP* |
| Ga0070671_1017771752 | 3300005355 | Switchgrass Rhizosphere | CGRSASPTGCAFAHIPTGTTANQRIDIDEEEDRSDAMTVAASAIGAGTEIGRATP* |
| Ga0070673_1006043141 | 3300005364 | Switchgrass Rhizosphere | GRSASPTGCAFAHIPTGTTANHRIDVDEEDDRSDAMTVAPRAIGADTEIGRATP* |
| Ga0070708_1018048532 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RSASPTGCAFAHIPTGTAANNSIDVDEGEGRSNVMSVAPGAIGAGTEIGRATP* |
| Ga0070699_1011954223 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ECRWICGRSASPTGCAFAHIPTGTTANHRIDIDQGEGRSSVMSVAPGAIGAGTEIGRATP |
| Ga0066699_108073692 | 3300005561 | Soil | VDMWTIGSTFTHLPTGTTANHRINVDEEEHRSDAMTVATSAIGAGREIGRATP* |
| Ga0070702_1014275382 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | AFAHIPTGTTANHRIDVDEEDDRSDAMTVAPRAIGADTEIGRATP* |
| Ga0070702_1014335721 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | ASPTGCAFAHIPTGTTTNHRIDVDEEEDSSDVMTVAPSAIGAGTELGRATP* |
| Ga0066903_1061173001 | 3300005764 | Tropical Forest Soil | PWICGRSASPTGCAFAHIPTGTAANHRIDIDEEKDESDAMTVAASAIGAGTEIGRATP* |
| Ga0081455_102049242 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LASPTGCAFAHIPTGTTTNYRIEVDEEEKSSEAMTVAPSAIGAGTEIGRVTP* |
| Ga0066651_100222081 | 3300006031 | Soil | NHRIDVDEEDYRSDVVTVAPAAIGAGVKIGGVTP* |
| Ga0070712_1018115281 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | AHIPTGTTANHRIDIDQGEGRSNVISVAPSAIGAGTEIGRTTP* |
| Ga0102924_12153163 | 3300007982 | Iron-Sulfur Acid Spring | FAHIPTGTTANHRIDVDEGEGSSDAMTVAPDAIGAGTEISRATP* |
| Ga0099829_100884243 | 3300009038 | Vadose Zone Soil | PTGATANHRIDIDEKERSSAMTVAPGAIGAGTEIGRAIP* |
| Ga0099830_112025611 | 3300009088 | Vadose Zone Soil | PTGCAFAHIPTGATANHRIDIDEEERNSAMTVAPGAIGAGTEIGRATP* |
| Ga0099830_117409341 | 3300009088 | Vadose Zone Soil | PTGCAFAHIPTGATANHRIDIDEEERNSAMTVAPGAIGAGTKIGRATP* |
| Ga0099828_107097242 | 3300009089 | Vadose Zone Soil | STGATDNHRIDIYEEERNSAMTVAPGAIGAGTKIGRATP* |
| Ga0099828_108661671 | 3300009089 | Vadose Zone Soil | CAFAHIPTGATANHRIDIDEEERNSAMTVAPGAIGAGTEIGRATP* |
| Ga0099828_114067212 | 3300009089 | Vadose Zone Soil | SASPTGCAFAHIPTGATANHRVDIDEEEKSSAMTVAPGAIGAGTEIGRATP* |
| Ga0099827_100965013 | 3300009090 | Vadose Zone Soil | CGRSASPTGCACAHIPTGTATNHRIDVDEEEDRSDAMTIATSAIGAGTEIGRATP* |
| Ga0099827_114490701 | 3300009090 | Vadose Zone Soil | GCAFAHIPTGATANHRIDIDEEERNSAMTVAPGATGAGTEIGRATP* |
| Ga0105245_122465822 | 3300009098 | Miscanthus Rhizosphere | GCAFAHIPTGTTANHRIDIDEGEDRSNVMSVAPSAIGAGTEIGRATP* |
| Ga0105247_103171341 | 3300009101 | Switchgrass Rhizosphere | AHIPTGTTANNRIDVDEEEDSSDVMTVAPGAIGAGTEIGRATP* |
| Ga0099792_106416311 | 3300009143 | Vadose Zone Soil | CGRSASPTGCAFAHIPTGTTANHRIDVDEEDYRSDVVTVAPAAIGAGVKIGGVTP* |
| Ga0099792_109465142 | 3300009143 | Vadose Zone Soil | PWICGRSASPTGCAFAHIPTGTTANHRIDVDEAEGKSDVMTVAPSAIGAGTEIGRATP* |
| Ga0126384_115615791 | 3300010046 | Tropical Forest Soil | TGTTANHRIDIDEGEGRSNVMSVATSEIAAGTEIGRATP* |
| Ga0127503_112072651 | 3300010154 | Soil | AFAHIPTGTIANQRIAIDEGEGRSNVISVAPSAIGAGTEIGRATP* |
| Ga0126381_1028204602 | 3300010376 | Tropical Forest Soil | PTGTTANHRIDVDEEEYRSNAMTVATSAIGAGTKLGEATP* |
| Ga0126381_1040793782 | 3300010376 | Tropical Forest Soil | GRSALPTGCAFAHIPTGTTDNHRIDVDDEKDRRNAMILAPGAIGTRTEIGWVTP* |
| Ga0126381_1048625901 | 3300010376 | Tropical Forest Soil | SPTGCAFAHIPTGTTANHRIDIDEGEGRSNVMSVATSAIAAGTEIGRATP* |
| Ga0136449_1018222182 | 3300010379 | Peatlands Soil | ASPTGCAFAHIPTGTTANHRNDVDEKEERSDAMTVAPGAIGAGTETGRATP* |
| Ga0150983_103238211 | 3300011120 | Forest Soil | RSASPTGCAFAHIPTGTTANHRIDVDEAEGKSDVMTALSAIGAGTEIGRATP* |
| Ga0137392_105330232 | 3300011269 | Vadose Zone Soil | SPTGCAFSHIPTGATANHRIDIEEKERSSAMTVAPGAIGAGTEISRATP* |
| Ga0137392_106109491 | 3300011269 | Vadose Zone Soil | ATANHRIDIDEKERSSAMTVAPGAIGAGTEIGRATP* |
| Ga0137391_100677734 | 3300011270 | Vadose Zone Soil | DMWTIGCAFAHISTATTANQRIDIDEGEGRSDVMTVAPGAIGAGTEIGRATP* |
| Ga0137391_106923312 | 3300011270 | Vadose Zone Soil | WICGRSASPTGCAFAHIPTGTTTNHRIDVDEEKDRSDAMTVATSAIGAGTEISRATP* |
| Ga0137393_100708855 | 3300011271 | Vadose Zone Soil | TGATANHRIDIDEEERSSAMTVAPGAIGAGTEIGRATP* |
| Ga0137389_107865272 | 3300012096 | Vadose Zone Soil | WICGRSASPTGCAFAHIPTGATANHRIDIDEEERSSAMTVAPGAIGAGTEIGRATP* |
| Ga0137374_102981044 | 3300012204 | Vadose Zone Soil | HIPTDTTANHRIDVDEAEGKSDVMTVAPSAIGACTEIGWATP* |
| Ga0137362_111754831 | 3300012205 | Vadose Zone Soil | GYAFDHIPTGTTAKHRVDVDKGEASSDVMTVAPGAIGAGTEIGRATP* |
| Ga0137381_102102081 | 3300012207 | Vadose Zone Soil | ICGRSASPTGCAFAHIPTGATANHRIDIDEEERNSAMTVAPGAIGAGTEIGRATP* |
| Ga0137376_115423482 | 3300012208 | Vadose Zone Soil | TGTTANHRTNVDEGYGRSDAITVAAGAIGADTKISRATP* |
| Ga0137379_104131763 | 3300012209 | Vadose Zone Soil | GRSASPTGCAFAHIPTGTTTNHRIDVDEEKDRSDAMTVATSAIGAGTEIGRATP* |
| Ga0137378_105167591 | 3300012210 | Vadose Zone Soil | AFAHIPTGATANHRIDIDEEERSSAMTVALSAIGAGTEIGRATP* |
| Ga0137377_115597252 | 3300012211 | Vadose Zone Soil | CAFAHIPTGTTANHRTNVDEGYGRSDAITVAAGAIGADTKIGRATP* |
| Ga0137377_116127152 | 3300012211 | Vadose Zone Soil | CAFAHIPTGTTANHRTNVDEGYGRSDAITVAAGAIGADTKISRATP* |
| Ga0137366_101425351 | 3300012354 | Vadose Zone Soil | GGAFAHIPTGATANHRIDIDAEERSSAMTVAPGAIGAGTEIGWATP* |
| Ga0137384_111492931 | 3300012357 | Vadose Zone Soil | AVAHIPTGATANHRIDIDEEERNSAMTVAPGAIGAGTEIGRATP* |
| Ga0137385_103673261 | 3300012359 | Vadose Zone Soil | AECPWICGRSASPTGGAFAHIPTGATANHRIDIDEAERSSAMTLAPGAIGAGTEIGRATP |
| Ga0137385_109639231 | 3300012359 | Vadose Zone Soil | ECPWICGRSASPTGGAFAHIPTGATANHRIDIDEEERSSAMTVAPGAIGAGTEIGRATP* |
| Ga0137360_109223461 | 3300012361 | Vadose Zone Soil | TGTAANHRIDIDEGEGRRNVMSVAPSAIAAGTEIGRATP* |
| Ga0137361_106706213 | 3300012362 | Vadose Zone Soil | AFAHIPTGTTTNHRIDVDEEKDRSDAMTVAPGAIGAGTEISRATP* |
| Ga0137390_103330103 | 3300012363 | Vadose Zone Soil | ATANHRIDIDEEERNSAMTVAPGAIGAGTKIGRATP* |
| Ga0137390_106320361 | 3300012363 | Vadose Zone Soil | ICGRSASPTGCAFAHIPTGTTTNHRIDVDEEKDRSDAMTVATSAIGAGTEISRATP* |
| Ga0137390_107918581 | 3300012363 | Vadose Zone Soil | GTTLNSRIDINHSKGRTDVITVAPSAIGAGIKIGRATP* |
| Ga0137390_109393641 | 3300012363 | Vadose Zone Soil | ICGRSASPTGCAFAHIPTGTTTNHRIDVDEEKDRSDAMTVAPGAIGAGTEISRATP* |
| Ga0150984_1046739281 | 3300012469 | Avena Fatua Rhizosphere | HIPTGTTASNRIDVDEEEGSRDVMTVAPVAIGAGTEIGGVTP* |
| Ga0137398_101570211 | 3300012683 | Vadose Zone Soil | PTGTTLNSRIDINHSKRRTDVITVAPSAIGAGIEIGRAIP* |
| Ga0137359_111716731 | 3300012923 | Vadose Zone Soil | TGYAFDHIPTGTTAKHRVDVDKGEANSDVMTVAPGAIGAGTEIGRATP* |
| Ga0137407_108970362 | 3300012930 | Vadose Zone Soil | CGRSASPTGCAFAHIPTGTTADHWIDVDEEEDRSDAMTVAPSAIGAGTEIGRATP* |
| Ga0157376_117092762 | 3300014969 | Miscanthus Rhizosphere | PTGCAFAHIPTGTTDNHRIDVDEEDDRSDAMTVAPRAIGADTEIGRATP* |
| Ga0134072_100839861 | 3300015357 | Grasslands Soil | AHITTGTTANHRIHVDEEEDRSDAMTVATSAIGAGTQIGRATP* |
| Ga0132256_1005217041 | 3300015372 | Arabidopsis Rhizosphere | HIPTGTTTNHRIDIDEEKDRSDAMTVSPGPIGAGTEIGRATP* |
| Ga0132257_1035940731 | 3300015373 | Arabidopsis Rhizosphere | AHIPTGTTANNRIDVDEEEDRSDVMTVAPGAIGAATEIGRATP* |
| Ga0132255_1014278481 | 3300015374 | Arabidopsis Rhizosphere | RSASPSGYAFAHIPTGTAANHRIDIDEEEDRSDAMTVAASAIGAGTEIGRATP* |
| Ga0182032_115782161 | 3300016357 | Soil | IPSGTTANQRIDIDEGEGRSKVISVTPSAIGTGTEIGRVTP |
| Ga0187825_101510824 | 3300017930 | Freshwater Sediment | AHIPTGTTTSHRIDVDEEEDRSDAMTVAPGATGAGTEIGRATP |
| Ga0066662_111286972 | 3300018468 | Grasslands Soil | CGRSASPTGCAFAHIPTGTTANHRIDVDEEDYRSDVVTVAPAAIGAGIKIGGVTP |
| Ga0066669_108621532 | 3300018482 | Grasslands Soil | RSASPTGCAFAHIPTGATANHRVDIDEEEKSGAMTVAPGAIGAGTEIGRATP |
| Ga0210395_102574061 | 3300020582 | Soil | PQPTGRAFAHIPPGTTANHRINGDEQEYRSNAMIIATSAIGAGTKLGRATP |
| Ga0210395_103389751 | 3300020582 | Soil | HPPGTTANHRINGDEQEYRSNAMTIATSAIGAGTKLSRATP |
| Ga0210405_100888451 | 3300021171 | Soil | SPTGCAFAHIPTGTPAYHGIDVDEGEGRSDVMTVAPSAIGAGTEIGRATP |
| Ga0210393_110215841 | 3300021401 | Soil | RYSPDGYGTTANHRIDVDEEDDRSDVMTVAPRAIGVGTKLGRATP |
| Ga0210397_114368712 | 3300021403 | Soil | HIPTGTTANHRIDIDEGEGRSDVMTVVSGATGAGTEIGRATP |
| Ga0210384_105109463 | 3300021432 | Soil | SPTGCAFAHIPTGTPAYHRIDVDEGEGRSDVMIVVPSAIGAGTEIGRATP |
| Ga0187846_104794832 | 3300021476 | Biofilm | TANHGIDIDERGGRSDAMTVAQSMIGADTEIGRATP |
| Ga0126371_110394451 | 3300021560 | Tropical Forest Soil | AANHRSNVDEEEESSDAMTVAPGAIGAGTEIGRVTP |
| Ga0126371_137009652 | 3300021560 | Tropical Forest Soil | LPFGCAFATSPTGATNHRIDSDDEDGKSDAVTVAPAAIGAGTEIDRATI |
| Ga0210073_10094653 | 3300025569 | Natural And Restored Wetlands | PTGTTANHRIDIDEKANRSDAMTVAPGAIGAGIEIGRVTP |
| Ga0207644_105389622 | 3300025931 | Switchgrass Rhizosphere | DCGRSASPTGCAFAHIPTGTTANQRIDIDEEEDRSDAMTVAASAIGAGTEIGRATP |
| Ga0207711_113498042 | 3300025941 | Switchgrass Rhizosphere | RRTGYAFAHIPAGTTANHRIDVDEEEDRSDAMTVATSAIGAGRATP |
| Ga0209734_10076081 | 3300027535 | Forest Soil | YGRSASPTGCAFAHIPTGTTANHRIDIDEGEGRSDVMTVAPAAIGAGTEIGRATP |
| Ga0209528_10432932 | 3300027610 | Forest Soil | GRSASPTGCAFAHIPTGTTANHRIDIDQGKGRSNVMSVAPSAIAAGTEIGRATP |
| Ga0209106_10461031 | 3300027616 | Forest Soil | RGWICGRSASPTGCAFAHIPTGTTANHRIDVDEAEGKSDVMTVAPSAIGAGTEIGRATP |
| Ga0209117_10471961 | 3300027645 | Forest Soil | PNGCAFAHIPTGTTANHRIDVDEEKGRSDAMTVAPSAIGAGTEIGRATPYTKSR |
| Ga0209217_10352355 | 3300027651 | Forest Soil | GCAFAHIPTGTTANHRIDIDEGEGRSNVISVAPSAIGAGTEIGRATP |
| Ga0209388_11079722 | 3300027655 | Vadose Zone Soil | PTGTTANHRIDIDQGEGRSNVMNVAPGAIGAGTEIGRATP |
| Ga0208989_100453711 | 3300027738 | Forest Soil | AFAHIPTGTTANHRIDVDQAEGKSDVMTVAPAAIGAGTEIGRATP |
| Ga0308189_103219672 | 3300031058 | Soil | CAFAHIPTGATANHRIDVDEDDYRSDVVTVAPAAIRAGVKIGGVTP |
| Ga0170822_160934741 | 3300031122 | Forest Soil | HIPTGTTANHRIDVDEAEGKSDLMTVAPSAIGAGTEIGRATP |
| Ga0170818_1026484101 | 3300031474 | Forest Soil | PVSRCRIANHRIDVDEVSDVMTIVPGAIGAGTENGRATP |
| Ga0310686_1036213531 | 3300031708 | Soil | PTCTTANHRIDVDEWEARSNVMTVAPGAIGAGTEIGRATP |
| Ga0310686_1132592034 | 3300031708 | Soil | TGRAFAHIPTGTTTNHRIDINEAGGRSDAMTVAPGAIGAGTEIGRATP |
| Ga0306921_124363162 | 3300031912 | Soil | TGCAFAHIPTGTTANHRMDVDEEERKRNVIALAPGAIGAETEIGRATP |
| Ga0310909_116360591 | 3300031947 | Soil | SASPTGCAFAHIPTGTANHRIDIDEGEGRSNVMSVATSAIAAGTEIGRATP |
| Ga0316052_1037002 | 3300032028 | Soil | LPTGCAFAHIPTGTTTNYRIEVDEEEHRSDAMTVATSAIGAGTEIGRATP |
| Ga0310911_101701941 | 3300032035 | Soil | AFADIPTGTTANHRMDVDEEERKSNVITAAPGAIGAETEIGRATP |
| Ga0306920_1011890442 | 3300032261 | Soil | RWICGRSTMPTGCAFAHIPTGTTANHRMDVDEEERKRNVIALAPGAIGAETEIGRATP |
| ⦗Top⦘ |