


| Basic Information | |
|---|---|
| Family ID | F097709 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LLWALSRMREGADPLALVAEAARHGIDIASLPAVAARLR |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.08 % |
| % of genes from short scaffolds (< 2000 bps) | 88.46 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.154 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.731 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.731 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.346 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF01411 | tRNA-synt_2c | 34.62 |
| PF00441 | Acyl-CoA_dh_1 | 9.62 |
| PF02771 | Acyl-CoA_dh_N | 4.81 |
| PF02798 | GST_N | 4.81 |
| PF07973 | tRNA_SAD | 3.85 |
| PF02661 | Fic | 2.88 |
| PF09594 | GT87 | 2.88 |
| PF00083 | Sugar_tr | 2.88 |
| PF07690 | MFS_1 | 1.92 |
| PF13561 | adh_short_C2 | 0.96 |
| PF00293 | NUDIX | 0.96 |
| PF05443 | ROS_MUCR | 0.96 |
| PF06983 | 3-dmu-9_3-mt | 0.96 |
| PF01609 | DDE_Tnp_1 | 0.96 |
| PF13594 | Obsolete Pfam Family | 0.96 |
| PF00005 | ABC_tran | 0.96 |
| PF07969 | Amidohydro_3 | 0.96 |
| PF00248 | Aldo_ket_red | 0.96 |
| PF03328 | HpcH_HpaI | 0.96 |
| PF02776 | TPP_enzyme_N | 0.96 |
| PF00437 | T2SSE | 0.96 |
| PF00950 | ABC-3 | 0.96 |
| PF02770 | Acyl-CoA_dh_M | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0013 | Alanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 34.62 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 15.38 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.96 |
| COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 0.96 |
| COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.96 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.96 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.96 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.96 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.96 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.96 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.96 |
| COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 0.96 |
| COG4957 | Predicted transcriptional regulator | Transcription [K] | 0.96 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.96 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.08 % |
| Unclassified | root | N/A | 26.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004009|Ga0055437_10115878 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300004080|Ga0062385_11113484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300004463|Ga0063356_105001845 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005180|Ga0066685_10515688 | Not Available | 827 | Open in IMG/M |
| 3300005338|Ga0068868_101411003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300005355|Ga0070671_102098744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300005540|Ga0066697_10445415 | Not Available | 746 | Open in IMG/M |
| 3300005559|Ga0066700_10301526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1129 | Open in IMG/M |
| 3300005561|Ga0066699_10152168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1579 | Open in IMG/M |
| 3300005575|Ga0066702_10024192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3016 | Open in IMG/M |
| 3300005586|Ga0066691_10199435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1165 | Open in IMG/M |
| 3300005764|Ga0066903_105848488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 645 | Open in IMG/M |
| 3300005764|Ga0066903_107417141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. KC8 | 566 | Open in IMG/M |
| 3300005872|Ga0058710_1007704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 531 | Open in IMG/M |
| 3300006046|Ga0066652_100118624 | Not Available | 2167 | Open in IMG/M |
| 3300006176|Ga0070765_100804031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 889 | Open in IMG/M |
| 3300006794|Ga0066658_10844518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300006854|Ga0075425_102854297 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006871|Ga0075434_101439138 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300007788|Ga0099795_10048546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1537 | Open in IMG/M |
| 3300009089|Ga0099828_11696885 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
| 3300009137|Ga0066709_104588301 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300010046|Ga0126384_12337915 | Not Available | 516 | Open in IMG/M |
| 3300010046|Ga0126384_12477567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 503 | Open in IMG/M |
| 3300010048|Ga0126373_10133102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2342 | Open in IMG/M |
| 3300010358|Ga0126370_10747129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 866 | Open in IMG/M |
| 3300010366|Ga0126379_11624077 | Not Available | 751 | Open in IMG/M |
| 3300010366|Ga0126379_13193434 | Not Available | 549 | Open in IMG/M |
| 3300010376|Ga0126381_102594031 | Not Available | 725 | Open in IMG/M |
| 3300010376|Ga0126381_104443571 | Not Available | 542 | Open in IMG/M |
| 3300012189|Ga0137388_11680130 | Not Available | 569 | Open in IMG/M |
| 3300012198|Ga0137364_10049484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2792 | Open in IMG/M |
| 3300012683|Ga0137398_10478168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 855 | Open in IMG/M |
| 3300012923|Ga0137359_10360928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1291 | Open in IMG/M |
| 3300012924|Ga0137413_10045663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2509 | Open in IMG/M |
| 3300012944|Ga0137410_10086987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2295 | Open in IMG/M |
| 3300012971|Ga0126369_10853865 | Not Available | 994 | Open in IMG/M |
| 3300013306|Ga0163162_13103516 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300014052|Ga0120109_1046514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 979 | Open in IMG/M |
| 3300014150|Ga0134081_10222460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 649 | Open in IMG/M |
| 3300014969|Ga0157376_11028909 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
| 3300016270|Ga0182036_10593132 | Not Available | 888 | Open in IMG/M |
| 3300016319|Ga0182033_10135193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1879 | Open in IMG/M |
| 3300016357|Ga0182032_11691221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 552 | Open in IMG/M |
| 3300016387|Ga0182040_11338437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300018064|Ga0187773_11228451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300018433|Ga0066667_11034180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
| 3300020006|Ga0193735_1017683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2220 | Open in IMG/M |
| 3300020579|Ga0210407_10717053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 775 | Open in IMG/M |
| 3300020582|Ga0210395_11347004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300021171|Ga0210405_10548709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 903 | Open in IMG/M |
| 3300021377|Ga0213874_10332912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300021403|Ga0210397_11437042 | Not Available | 536 | Open in IMG/M |
| 3300021407|Ga0210383_11380122 | Not Available | 587 | Open in IMG/M |
| 3300021432|Ga0210384_10405927 | Not Available | 1227 | Open in IMG/M |
| 3300021444|Ga0213878_10083876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1280 | Open in IMG/M |
| 3300021560|Ga0126371_10462126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1416 | Open in IMG/M |
| 3300021560|Ga0126371_10838333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1065 | Open in IMG/M |
| 3300021861|Ga0213853_10883135 | Not Available | 582 | Open in IMG/M |
| 3300025903|Ga0207680_11084050 | Not Available | 573 | Open in IMG/M |
| 3300025915|Ga0207693_10202204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1562 | Open in IMG/M |
| 3300025915|Ga0207693_10389574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1090 | Open in IMG/M |
| 3300025916|Ga0207663_10371429 | Not Available | 1087 | Open in IMG/M |
| 3300025928|Ga0207700_10734016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 882 | Open in IMG/M |
| 3300026552|Ga0209577_10357835 | Not Available | 1071 | Open in IMG/M |
| 3300027182|Ga0208952_1009761 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Ixodinae → Ixodes → Ixodes ricinus | 531 | Open in IMG/M |
| 3300027846|Ga0209180_10111115 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300027882|Ga0209590_10198533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1267 | Open in IMG/M |
| 3300028906|Ga0308309_11780438 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae → Ixodinae → Ixodes → Ixodes ricinus | 521 | Open in IMG/M |
| 3300031469|Ga0170819_13110013 | Not Available | 515 | Open in IMG/M |
| 3300031546|Ga0318538_10123479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1353 | Open in IMG/M |
| 3300031546|Ga0318538_10380366 | Not Available | 763 | Open in IMG/M |
| 3300031640|Ga0318555_10590353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300031680|Ga0318574_10739090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300031708|Ga0310686_118864228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1008 | Open in IMG/M |
| 3300031748|Ga0318492_10295862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Stappiaceae → Labrenzia → unclassified Labrenzia → Labrenzia sp. 011 | 842 | Open in IMG/M |
| 3300031753|Ga0307477_10947979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 566 | Open in IMG/M |
| 3300031765|Ga0318554_10599907 | Not Available | 621 | Open in IMG/M |
| 3300031768|Ga0318509_10639050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 592 | Open in IMG/M |
| 3300031769|Ga0318526_10011455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2886 | Open in IMG/M |
| 3300031769|Ga0318526_10178493 | Not Available | 866 | Open in IMG/M |
| 3300031781|Ga0318547_10012370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3965 | Open in IMG/M |
| 3300031819|Ga0318568_10715661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 622 | Open in IMG/M |
| 3300031819|Ga0318568_10875711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 556 | Open in IMG/M |
| 3300031859|Ga0318527_10331626 | Not Available | 648 | Open in IMG/M |
| 3300031890|Ga0306925_10017076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 7164 | Open in IMG/M |
| 3300031897|Ga0318520_10379749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 861 | Open in IMG/M |
| 3300031897|Ga0318520_10489434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 759 | Open in IMG/M |
| 3300031910|Ga0306923_10667977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1160 | Open in IMG/M |
| 3300031945|Ga0310913_11303708 | Not Available | 504 | Open in IMG/M |
| 3300031959|Ga0318530_10335959 | Not Available | 625 | Open in IMG/M |
| 3300031965|Ga0326597_10093194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3679 | Open in IMG/M |
| 3300032009|Ga0318563_10705122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300032041|Ga0318549_10515049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 538 | Open in IMG/M |
| 3300032042|Ga0318545_10004442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3936 | Open in IMG/M |
| 3300032052|Ga0318506_10102113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1226 | Open in IMG/M |
| 3300032054|Ga0318570_10502236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 553 | Open in IMG/M |
| 3300032064|Ga0318510_10222875 | Not Available | 768 | Open in IMG/M |
| 3300032066|Ga0318514_10749463 | Not Available | 519 | Open in IMG/M |
| 3300032089|Ga0318525_10105404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1438 | Open in IMG/M |
| 3300032091|Ga0318577_10067599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1632 | Open in IMG/M |
| 3300032094|Ga0318540_10136451 | Not Available | 1171 | Open in IMG/M |
| 3300032180|Ga0307471_103421727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 562 | Open in IMG/M |
| 3300032896|Ga0335075_10967369 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Bulk Soil | 1.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.96% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005872 | Bulk soil microbial communities from Harvard Forest, USA - 3Bulk_unsorted metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027182 | Bulk soil microbial communities from Harvard Forest, USA - 3Bulk_unsorted metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055437_101158782 | 3300004009 | Natural And Restored Wetlands | RSTLLWALTRLREGDDPAALVALGAKNGVDIAALPAVAARLR* |
| Ga0062385_111134842 | 3300004080 | Bog Forest Soil | SGTRSALLWALTRMRDGADPLALIAEAARHGIDIAGLPAVAARLR* |
| Ga0063356_1050018452 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TRSTLLWALVRLREGADPSALIGEAARHGIDIAALPAIAARLR* |
| Ga0066685_105156882 | 3300005180 | Soil | LLWALSRMRERADPLALIAEAARHGIDIAGLPAVAARLR* |
| Ga0068868_1014110033 | 3300005338 | Miscanthus Rhizosphere | LLWALVRLREGAEPSSLVAEAARYGIDIAALPAIAARLR* |
| Ga0070671_1020987441 | 3300005355 | Switchgrass Rhizosphere | SGTRSTLLWALVRLREGAEPLQLVAEAARYGIDIAALPVIAARL* |
| Ga0066697_104454151 | 3300005540 | Soil | TRSALLWALSRMRERADPLALIAEAARHGIDIAGLPAVAARLR* |
| Ga0066700_103015261 | 3300005559 | Soil | SALLWALARMREGADPNALVAEAACHGIDIAALPAIAARLR* |
| Ga0066699_101521682 | 3300005561 | Soil | LLWALTRMREGENALSLIAEAAQHGIDIAGLPAVAARLR* |
| Ga0066702_100241921 | 3300005575 | Soil | CRSGTRSALLWALTRMREGANSLSLIAEAAQHGIDIAGLPAVAARLR* |
| Ga0066691_101994352 | 3300005586 | Soil | GTRSTLLWALARMREGADPFALVAEAARHGIDIAALPAIAARLR* |
| Ga0066903_1058484882 | 3300005764 | Tropical Forest Soil | VRMREGADPLSLVAEAAHHGIDIANLPAVAARLR* |
| Ga0066903_1074171411 | 3300005764 | Tropical Forest Soil | RSALLWALVRMREGADALSLIATAAQHGIDIANLPAVAARLR* |
| Ga0058710_10077042 | 3300005872 | Bulk Soil | SALLWALARMREGADPGSLIAEAARHGIDIAALPAFAARLR* |
| Ga0066652_1001186241 | 3300006046 | Soil | LSRMRERADPLALIAEAARHGIDIAALPAVAARLR* |
| Ga0070765_1008040311 | 3300006176 | Soil | TRSALLWALARMREGADPGSLIAEAARHGIDIAALPAFAARLR* |
| Ga0066658_108445181 | 3300006794 | Soil | GTRSALLWALARLRQGDDPAALVAEAARHGIDIAALPALAARLG* |
| Ga0075425_1028542971 | 3300006854 | Populus Rhizosphere | SGTRSTLLWSLTRIDQGADPAALVAQAARNGIDIAALPMIAARLR* |
| Ga0075434_1014391381 | 3300006871 | Populus Rhizosphere | SGTRSTLLWALVRMREGADPLSLIAEAAHHGIDIAGLPAVAARLR* |
| Ga0099795_100485462 | 3300007788 | Vadose Zone Soil | STLLWALMRMREGANALSLIAEAAQHGVDIASLPAVAARLR* |
| Ga0099828_116968851 | 3300009089 | Vadose Zone Soil | LLWALARMRDGADPLALVGEAARHGIDIAALPTIAARLR* |
| Ga0066709_1045883012 | 3300009137 | Grasslands Soil | ALHWEWERIRASADPVALVAEAARHGIDIAALPAIAARLR* |
| Ga0126384_123379151 | 3300010046 | Tropical Forest Soil | TRSALLWALTRLRDGADPLSLITTAAQHGIDIAGLPALAARLR* |
| Ga0126384_124775672 | 3300010046 | Tropical Forest Soil | ALLWALSRMRERADPLALIAEAARHGIDIASLPAVAARLR* |
| Ga0126373_101331021 | 3300010048 | Tropical Forest Soil | LLWALTRLREGADPLSLIATAAQHGIDIAGLPAVAARLR* |
| Ga0126370_107471293 | 3300010358 | Tropical Forest Soil | LTQLDEGADPAALIERAARQGIDIAALPAFAARLR* |
| Ga0126379_116240771 | 3300010366 | Tropical Forest Soil | GRMREGADPLALVAEAARHGIDIASLAAVAARLR* |
| Ga0126379_131934342 | 3300010366 | Tropical Forest Soil | TRMRQGANAFSLIAEAAQHGIDIASLPAVAARLR* |
| Ga0126381_1025940311 | 3300010376 | Tropical Forest Soil | SALLWALTRLREGADPLSLIAEAARHGIDIAGLPAVAARLR* |
| Ga0126381_1044435711 | 3300010376 | Tropical Forest Soil | SGTRSALLWALTRLREGADPLSLIATAAQHGIDIAGLPAVAARLR* |
| Ga0137388_116801301 | 3300012189 | Vadose Zone Soil | LVALPRMREGADPLSLIAEVAGHGIDIATLPAVAARLR* |
| Ga0137364_100494844 | 3300012198 | Vadose Zone Soil | ALTRLDEGADANALIATAAAYGIDIAALPAIAARLG* |
| Ga0137398_104781682 | 3300012683 | Vadose Zone Soil | LIWALTRLREGADPNALIAQAARHGIDIAALPAIAARLG* |
| Ga0137359_103609283 | 3300012923 | Vadose Zone Soil | LWALSRMRDRADPLALIAEAARHGIDIAGLPAVAARLR* |
| Ga0137413_100456631 | 3300012924 | Vadose Zone Soil | SGTRSTLLWALMRMREGANALSLIAEAAQHGVDIASLPAVAARLR* |
| Ga0137410_100869872 | 3300012944 | Vadose Zone Soil | STLLWALTRMREGANALSLIAEAAQHGIDIASLPAVAARLR* |
| Ga0126369_108538651 | 3300012971 | Tropical Forest Soil | VRMREGADPLSLIAEAARHGIDIANLPAVAARLR* |
| Ga0163162_131035161 | 3300013306 | Switchgrass Rhizosphere | ALVQLREGADPTALIGEAARHGIDIASLPAIAARLR* |
| Ga0120109_10465141 | 3300014052 | Permafrost | TRSTLLWALTRLGEGADPALLVAEAARHGIDIAALPVIAARLG* |
| Ga0134081_102224602 | 3300014150 | Grasslands Soil | TRLDEGADANALIATAAAYGIDIAALPAIAARLG* |
| Ga0157376_110289092 | 3300014969 | Miscanthus Rhizosphere | VVPEELSSRLDDGADANGLIATAARYGIDIAALPAIAARLG* |
| Ga0182036_105931321 | 3300016270 | Soil | HCRSGTRSALLWALVRMREGADALSLIATAARHGIDIASLPAVAARLR |
| Ga0182033_101351931 | 3300016319 | Soil | SGTRSTLLWALSRMREGADPLALVAEAARHGIDIASLPAVAARLR |
| Ga0182032_116912212 | 3300016357 | Soil | RSTLLWALTRMREGADPLALVAEASRHGIDIASLPAVAARLR |
| Ga0182040_113384371 | 3300016387 | Soil | HCRSGTRSALLWALVRMREGADPLSLVAEVARHGIDIANLPAVAARLR |
| Ga0187773_112284511 | 3300018064 | Tropical Peatland | TLLWALTRLREGADPFALVAEAARHGIDIASLPAIAARLR |
| Ga0066667_110341801 | 3300018433 | Grasslands Soil | LLWALTRLDEGADANALIATAAAYGIDIAALPAIAARLG |
| Ga0193735_10176833 | 3300020006 | Soil | ALTRLDEGADANALIATAAAYGIDIAALPAIAARLG |
| Ga0210407_107170532 | 3300020579 | Soil | TLLWALTRMREGANALSLIAEAAQHGIDIASLPAVAARLR |
| Ga0210395_113470042 | 3300020582 | Soil | WALTRLREGADPLALIAEAARHGIDIAGLPSVAARLRQMP |
| Ga0210405_105487091 | 3300021171 | Soil | TLLWALTRMREGGNALSLIAEAAQHGIDIAGLPAVAARLR |
| Ga0213874_103329121 | 3300021377 | Plant Roots | LWALTRLRDGADPLTLIAEAARHGIDIAGLPAVAARLR |
| Ga0210397_114370421 | 3300021403 | Soil | LLWALSRMRERADPLALIAEAARHGIDIASLPAVAARLR |
| Ga0210383_113801221 | 3300021407 | Soil | CRSGTRSALLWALTRMREGANALSLIAEAAQHGIDIAGLPAVAARLR |
| Ga0210384_104059272 | 3300021432 | Soil | RSGTRSALLWALTRVREGGNSLSLIAEAAQHGIDIASLPAVAARLR |
| Ga0213878_100838762 | 3300021444 | Bulk Soil | CRSGTRSALLWALTRMREGANALSLIAEAAQYGIDIAGLPAVAARLR |
| Ga0126371_104621261 | 3300021560 | Tropical Forest Soil | TRSALLWALTRLRGGADPLSLIAEAARHGIDIAGLPAVAARLR |
| Ga0126371_108383331 | 3300021560 | Tropical Forest Soil | HCRSGTRSALLWALVRMREGADALSLIATAAQHGIDIASLPAVAARLR |
| Ga0213853_108831351 | 3300021861 | Watersheds | LTRMAEGADPAALVAVAARHGIDIAALPVIAARLR |
| Ga0207680_110840502 | 3300025903 | Switchgrass Rhizosphere | LLWALVRMREGADPFALIGEAARHGIDIAALPTIAARLR |
| Ga0207693_102022043 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ALTRLREGADPNTLIAEAARHGIDIAALPAIAARLS |
| Ga0207693_103895742 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GTRSALLWALTRMREGANALSLIAEAAQHGIDIAGLPAVAARLR |
| Ga0207663_103714292 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | SGTRSTLLWALTRLDDGADANGLIATAARYGIDIAALPAIAARLG |
| Ga0207700_107340161 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RSALLCLTRMREGADPLSLIAAAAHHGIDIPGLPAIAARLR |
| Ga0209577_103578352 | 3300026552 | Soil | SGTRSALLWALARMREGADPFALVAEAARHGIDIAALPAIAARLP |
| Ga0208952_10097611 | 3300027182 | Bulk Soil | SALLWALARMREGADPGSLIAEAARHGIDIAALPAFAARLR |
| Ga0209180_101111151 | 3300027846 | Vadose Zone Soil | WALARMRDGADPLALVAAAARHGIDIAALPAIAARLR |
| Ga0209590_101985333 | 3300027882 | Vadose Zone Soil | LLWALARMRDGADPSALVAEAARHGIDIAALPAIAARLG |
| Ga0308309_117804382 | 3300028906 | Soil | TRSTLLWALTRMREGADPFALVAEAARHGIDIAALPAIATRLR |
| Ga0170819_131100132 | 3300031469 | Forest Soil | WALSRMRERADPLALIAEAARHGIDIAGLPAVAARLR |
| Ga0318538_101234791 | 3300031546 | Soil | SGTRSMLLWALSRMREGADPFALVAEAGRHGIDIASLPAIAARLR |
| Ga0318538_103803661 | 3300031546 | Soil | RSGTRSALLWALVRMREGADALSLIATAARHGIDIASLPAVAARLR |
| Ga0318555_105903532 | 3300031640 | Soil | LWALTRLRDGADPLSLIAEAARHGIDIAGLPAVAARLR |
| Ga0318574_107390902 | 3300031680 | Soil | GTRSALLWGLTRLREGADPLALIAAAARHGIDIAGLPAIAARLR |
| Ga0310686_1188642282 | 3300031708 | Soil | WALTRMREGADPLALISEAARHGIDIAGLPAVAARLR |
| Ga0318492_102958621 | 3300031748 | Soil | STLLWALTRMREGADPLGLIAEAARHGIDIASLPAVAARLR |
| Ga0307477_109479791 | 3300031753 | Hardwood Forest Soil | LLWALSRMREGADPLALVAEAARHGIDIASLPAVAARLR |
| Ga0318554_105999072 | 3300031765 | Soil | WALVRMREGADALSLIATAARHGIDIASLPAVAARLR |
| Ga0318509_106390501 | 3300031768 | Soil | RTGTRSTLLWALVRMREGADALALVAEAARHGIDIASLPAVAARLR |
| Ga0318526_100114551 | 3300031769 | Soil | LWALGRMREGADPLALVAEAARHGIDIASLPAVAARLR |
| Ga0318526_101784931 | 3300031769 | Soil | WALTRLRDGVDPLSLIAEAARHGIDIAGLPAVAARLR |
| Ga0318547_100123703 | 3300031781 | Soil | ALGRMREGADPLALVAEAARHGIDIASLPAVAARLR |
| Ga0318568_107156612 | 3300031819 | Soil | LWALTRMREGADPLALVAEAARHGIDIASLPSVAARLR |
| Ga0318568_108757112 | 3300031819 | Soil | LLWALSRMREGADPFALVAEAARHGIDIASLPAIAARLR |
| Ga0318527_103316261 | 3300031859 | Soil | RSGTRSTLLWALTRMREGANSLSLIAEAAGHGIDIASLPAVAARLR |
| Ga0306925_100170767 | 3300031890 | Soil | TRSTLLWALSRMREGADPFALVAEAGRHGIDIASLPAIAARLR |
| Ga0318520_103797491 | 3300031897 | Soil | LWALSRMREGADPLALVAEAARHGIDIASLPAVAARLR |
| Ga0318520_104894341 | 3300031897 | Soil | LWALSRMREGADPFALVAEAARHGIDIASLPAIAARLR |
| Ga0306923_106679771 | 3300031910 | Soil | TLLWALSRMREGADPFALVAEAGRHGIDIASLPAVGVRLR |
| Ga0310913_113037081 | 3300031945 | Soil | TLLWALSQMREGADPFALVAEAARHGIDIASLPAIAARLR |
| Ga0318530_103359591 | 3300031959 | Soil | LVRMREGADPFALVAEAARHGIDIAGLPAVAARLR |
| Ga0326597_100931941 | 3300031965 | Soil | RSGTRSSLLWALVRLRDGDDPSALVAQAARHGINIAALPAIAARLG |
| Ga0318563_107051221 | 3300032009 | Soil | LWALTRMREGANALSLIAEAAQHGIDIAGLPAVAARLR |
| Ga0318549_105150491 | 3300032041 | Soil | LWALSRMREGADPFALVAEAGRHGIDIASLPAIAARLR |
| Ga0318545_100044423 | 3300032042 | Soil | ALSRMREGADPLALVAEAARHGIDIASLPAVAARLR |
| Ga0318506_101021132 | 3300032052 | Soil | ALLWALTRMHEGADPLALIAEVARHGIDIGDLPAIAARLR |
| Ga0318570_105022361 | 3300032054 | Soil | ALLWALTRMREGADPLSLIAEAGKHGIDIAGLPAIAARLR |
| Ga0318510_102228751 | 3300032064 | Soil | WALTRLRDGADPLSLIAEAARHGIDIAGLPAVAARLR |
| Ga0318514_107494631 | 3300032066 | Soil | GTRSTLLWALSRMREGADPLALVAEAARQGIDIASLPAVAARLR |
| Ga0318525_101054042 | 3300032089 | Soil | LWALGRMREGADPFALVAEAARHGIDIASLPAVAARLR |
| Ga0318577_100675991 | 3300032091 | Soil | STLLWALVRMREGADALGLVAEAARHGIDIASLPAVAARLR |
| Ga0318540_101364512 | 3300032094 | Soil | LWALTRMREGANSLSLIAEAAGHGIDIASLPAVAARLR |
| Ga0307471_1034217271 | 3300032180 | Hardwood Forest Soil | TRSTLLWALSRMREGADPLALVAEAARHGIDIASLPAVAARLR |
| Ga0335075_109673691 | 3300032896 | Soil | LVRLRDGDDPAGLIGQAARSGIDIAALPAIAARLGL |
| ⦗Top⦘ |