


| Basic Information | |
|---|---|
| Family ID | F097692 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LAGDVMRESVGEHSMVATDLLRGLPEAFRRAQKAAQEKFVRWGG |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.92 % |
| % of genes near scaffold ends (potentially truncated) | 98.08 % |
| % of genes from short scaffolds (< 2000 bps) | 90.38 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.577 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.192 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.846 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF02367 | TsaE | 13.46 |
| PF01408 | GFO_IDH_MocA | 10.58 |
| PF07238 | PilZ | 4.81 |
| PF01541 | GIY-YIG | 0.96 |
| PF05050 | Methyltransf_21 | 0.96 |
| PF13643 | DUF4145 | 0.96 |
| PF00326 | Peptidase_S9 | 0.96 |
| PF05977 | MFS_3 | 0.96 |
| PF07786 | HGSNAT_cat | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0802 | tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaE | Translation, ribosomal structure and biogenesis [J] | 13.46 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.96 |
| COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.58 % |
| Unclassified | root | N/A | 39.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10049148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2274 | Open in IMG/M |
| 3300004091|Ga0062387_100293053 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300004152|Ga0062386_101841316 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005542|Ga0070732_10473615 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005552|Ga0066701_10263029 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300005569|Ga0066705_10498637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
| 3300005591|Ga0070761_10689616 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300005764|Ga0066903_106022122 | Not Available | 635 | Open in IMG/M |
| 3300005921|Ga0070766_10374644 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300005993|Ga0080027_10227264 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300006052|Ga0075029_100869263 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300006086|Ga0075019_10468960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 777 | Open in IMG/M |
| 3300006162|Ga0075030_100078665 | All Organisms → cellular organisms → Bacteria | 2708 | Open in IMG/M |
| 3300006176|Ga0070765_101841172 | Not Available | 567 | Open in IMG/M |
| 3300006358|Ga0068871_101995178 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300006893|Ga0073928_10856949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300006954|Ga0079219_10475274 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300007258|Ga0099793_10544066 | Not Available | 579 | Open in IMG/M |
| 3300009174|Ga0105241_11611518 | Not Available | 628 | Open in IMG/M |
| 3300009552|Ga0116138_1238200 | Not Available | 503 | Open in IMG/M |
| 3300009638|Ga0116113_1023078 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300009698|Ga0116216_10312775 | Not Available | 957 | Open in IMG/M |
| 3300010339|Ga0074046_10219092 | Not Available | 1191 | Open in IMG/M |
| 3300010343|Ga0074044_11007363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300010376|Ga0126381_103935999 | Not Available | 579 | Open in IMG/M |
| 3300010379|Ga0136449_101692499 | Not Available | 954 | Open in IMG/M |
| 3300010379|Ga0136449_104687804 | Not Available | 500 | Open in IMG/M |
| 3300010398|Ga0126383_10257327 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300010400|Ga0134122_10468545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1131 | Open in IMG/M |
| 3300011120|Ga0150983_14880359 | Not Available | 507 | Open in IMG/M |
| 3300012202|Ga0137363_11600254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300012203|Ga0137399_10392377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1157 | Open in IMG/M |
| 3300012206|Ga0137380_10163948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2025 | Open in IMG/M |
| 3300012211|Ga0137377_10038047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4396 | Open in IMG/M |
| 3300012359|Ga0137385_11157723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300012683|Ga0137398_10022774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3429 | Open in IMG/M |
| 3300012925|Ga0137419_10982315 | Not Available | 699 | Open in IMG/M |
| 3300012960|Ga0164301_10470983 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300013306|Ga0163162_10562405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1268 | Open in IMG/M |
| 3300014501|Ga0182024_12753013 | Not Available | 525 | Open in IMG/M |
| 3300014969|Ga0157376_10065634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3066 | Open in IMG/M |
| 3300017822|Ga0187802_10342907 | Not Available | 586 | Open in IMG/M |
| 3300017940|Ga0187853_10380184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 627 | Open in IMG/M |
| 3300017943|Ga0187819_10386905 | Not Available | 805 | Open in IMG/M |
| 3300017959|Ga0187779_10661242 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300017970|Ga0187783_10716231 | Not Available | 722 | Open in IMG/M |
| 3300017973|Ga0187780_10981522 | Not Available | 615 | Open in IMG/M |
| 3300018038|Ga0187855_10286784 | Not Available | 964 | Open in IMG/M |
| 3300018043|Ga0187887_10548379 | Not Available | 682 | Open in IMG/M |
| 3300018043|Ga0187887_10683011 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300018044|Ga0187890_10316023 | Not Available | 877 | Open in IMG/M |
| 3300018088|Ga0187771_10678601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RBG_13_68_16 | 874 | Open in IMG/M |
| 3300018090|Ga0187770_10589151 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300018090|Ga0187770_11624378 | Not Available | 527 | Open in IMG/M |
| 3300020579|Ga0210407_10465137 | Not Available | 989 | Open in IMG/M |
| 3300021170|Ga0210400_10225371 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300021171|Ga0210405_10610732 | Not Available | 849 | Open in IMG/M |
| 3300021405|Ga0210387_10211655 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300021433|Ga0210391_11315053 | Not Available | 557 | Open in IMG/M |
| 3300021478|Ga0210402_10281786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1537 | Open in IMG/M |
| 3300021478|Ga0210402_10770276 | Not Available | 887 | Open in IMG/M |
| 3300021479|Ga0210410_10809666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 822 | Open in IMG/M |
| 3300022557|Ga0212123_10178976 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300022726|Ga0242654_10213113 | Not Available | 677 | Open in IMG/M |
| 3300024271|Ga0224564_1075458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 674 | Open in IMG/M |
| 3300025986|Ga0207658_11504803 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300026281|Ga0209863_10254420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300026551|Ga0209648_10203681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1508 | Open in IMG/M |
| 3300026557|Ga0179587_10978799 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300026984|Ga0208732_1028403 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300027587|Ga0209220_1003713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4109 | Open in IMG/M |
| 3300027609|Ga0209221_1135609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 618 | Open in IMG/M |
| 3300027652|Ga0209007_1132162 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300027745|Ga0209908_10122354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 663 | Open in IMG/M |
| 3300027826|Ga0209060_10130265 | Not Available | 1171 | Open in IMG/M |
| 3300027846|Ga0209180_10624301 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300027889|Ga0209380_10324171 | Not Available | 905 | Open in IMG/M |
| 3300027895|Ga0209624_10830164 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300027898|Ga0209067_10373817 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 794 | Open in IMG/M |
| 3300027911|Ga0209698_10794731 | Not Available | 715 | Open in IMG/M |
| 3300028017|Ga0265356_1034452 | Not Available | 553 | Open in IMG/M |
| 3300028748|Ga0302156_10254488 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300028759|Ga0302224_10067202 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300029636|Ga0222749_10764563 | Not Available | 529 | Open in IMG/M |
| 3300029907|Ga0311329_10174232 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
| 3300029910|Ga0311369_10155172 | All Organisms → cellular organisms → Bacteria | 2198 | Open in IMG/M |
| 3300029943|Ga0311340_10045145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5273 | Open in IMG/M |
| 3300029943|Ga0311340_11166063 | Not Available | 622 | Open in IMG/M |
| 3300030520|Ga0311372_11994077 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300030740|Ga0265460_10733557 | Not Available | 848 | Open in IMG/M |
| 3300030743|Ga0265461_13609925 | Not Available | 525 | Open in IMG/M |
| 3300030763|Ga0265763_1015413 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300031057|Ga0170834_103474645 | Not Available | 757 | Open in IMG/M |
| 3300031090|Ga0265760_10004586 | All Organisms → cellular organisms → Bacteria | 3960 | Open in IMG/M |
| 3300031231|Ga0170824_111014700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1269 | Open in IMG/M |
| 3300031708|Ga0310686_106216256 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
| 3300031753|Ga0307477_10440596 | Not Available | 889 | Open in IMG/M |
| 3300031941|Ga0310912_11012039 | Not Available | 637 | Open in IMG/M |
| 3300031996|Ga0308176_11387809 | Not Available | 747 | Open in IMG/M |
| 3300032783|Ga0335079_11340975 | Not Available | 713 | Open in IMG/M |
| 3300032828|Ga0335080_12312731 | Not Available | 514 | Open in IMG/M |
| 3300032898|Ga0335072_10525071 | Not Available | 1217 | Open in IMG/M |
| 3300033134|Ga0335073_10312073 | All Organisms → cellular organisms → Bacteria | 1881 | Open in IMG/M |
| 3300033829|Ga0334854_019810 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.62% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.77% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.81% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.92% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.92% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.92% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.92% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.96% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100491484 | 3300000567 | Peatlands Soil | REILGEHSLVATDLLRGLPDAFESARQTVREKFVCWEG* |
| Ga0062387_1002930531 | 3300004091 | Bog Forest Soil | DVMRESVGEHSMVATDLLRGLPEAFWRAQKTAQEKFVRWDG* |
| Ga0062386_1018413161 | 3300004152 | Bog Forest Soil | HGRAGDEMREILGEHSLVATDLLRGLPDAFESARQTVREKFVCWEG* |
| Ga0070732_104736151 | 3300005542 | Surface Soil | VMRESVGELSLVATDLLHGLPEAFRRTRATAKQKLVCWGG* |
| Ga0066701_102630291 | 3300005552 | Soil | GLAGDIARETMGEQSLVATDLVRSLPQAFHRARRNAQEKLAKICG* |
| Ga0066705_104986373 | 3300005569 | Soil | GEHSLLATDLLEGLPEAFRRTWQAAQEKFVRWGA* |
| Ga0070761_106896161 | 3300005591 | Soil | HGLAGDVMRDKIGEHSLVATDLLLGLPEAFRRSQEAFGQKFVCWT* |
| Ga0066903_1060221222 | 3300005764 | Tropical Forest Soil | IVGEHSLVATDLLQGLPDAFERARAAAENKFAGWDG* |
| Ga0070766_103746442 | 3300005921 | Soil | LSGDVMRESVGEHSMVATDLLRGLPEAFHRSRQAAKETFVSWED* |
| Ga0080027_102272642 | 3300005993 | Prmafrost Soil | SAGDVMRESVGELPLVATDLLQGLPEGLRRTRRDAEGKIVRWDG* |
| Ga0075029_1008692631 | 3300006052 | Watersheds | GLAGDVMLDNVGEHSMVATDLLRGLPEAFWSAQRTAREKFVRWGG* |
| Ga0075019_104689602 | 3300006086 | Watersheds | VGEHSLVATDLLRGLPDAFQHAQKAALEKFVRWNG* |
| Ga0075030_1000786652 | 3300006162 | Watersheds | MLDNVGEHSMVATDLLRGLPEAFWSAQRTAREKFVRWGG* |
| Ga0070765_1018411721 | 3300006176 | Soil | ENVGEHSLVATDLLQGLPEAFRRTQEAAREKMVRWGG* |
| Ga0068871_1019951781 | 3300006358 | Miscanthus Rhizosphere | DIARESMGEHSLVATDLVKALPAAFRRTREAAAERFSYIQAQP* |
| Ga0073928_108569492 | 3300006893 | Iron-Sulfur Acid Spring | GDVMRESVGEHSLVATDLLRGLPEAFRRTQNAINEKSVCWGG* |
| Ga0079219_104752742 | 3300006954 | Agricultural Soil | GLAGDVMRDVVGEHSLVATDLLRGLPDAFERARAAARDKFVGWDG* |
| Ga0099793_105440662 | 3300007258 | Vadose Zone Soil | GFAGDVMRESVGEHSLVATDLLQGLPEAFRCAREAAREKVVCWGG* |
| Ga0105241_116115182 | 3300009174 | Corn Rhizosphere | AGDIACETMGEQPLVATDLIKALPEAFRRAQKAADEKFVKIAG* |
| Ga0116138_12382002 | 3300009552 | Peatland | VMRESVGEHSLVATYLLRGLPDAFRRTRETAREKFVPLGR* |
| Ga0116113_10230781 | 3300009638 | Peatland | AGDVMREIVGEHSLVATDLLKGLPDAFRRTREMAEEKPVRW* |
| Ga0116216_103127751 | 3300009698 | Peatlands Soil | GLAGDVMRQSVGEHSMVATDLLRGLPEAFLHAQRTAREKFAGWNG* |
| Ga0074046_102190921 | 3300010339 | Bog Forest Soil | ETVGEHSLVATDLVRGLPDAFDRARQTAREKFVCWEG* |
| Ga0074044_110073631 | 3300010343 | Bog Forest Soil | HGLAGDVMRETVGEHSLVATDLLAGLPEAFRRTQQAALNKLACW* |
| Ga0126381_1039359991 | 3300010376 | Tropical Forest Soil | SMIATDLLEGLPEAFRSAWQTAEEKFVRWGGGFSA* |
| Ga0136449_1016924992 | 3300010379 | Peatlands Soil | AGDVMRESVGEHSMVATDLLRGLPEAFLRAQTTAREKFVGWNG* |
| Ga0136449_1046878041 | 3300010379 | Peatlands Soil | VGEHSMVATDLLRGLPEAFRRSQKAARESFASWEG* |
| Ga0126383_102573273 | 3300010398 | Tropical Forest Soil | LHGLAGDVMLKQVGEHSMVATDLLTGLPEAFFATRKTASRKFVPLGA* |
| Ga0134122_104685453 | 3300010400 | Terrestrial Soil | GDIARESMGEHSLVATDLVKALPPAFRRTREAAAERFSYIQAQP* |
| Ga0150983_148803592 | 3300011120 | Forest Soil | RETVGEHSMVATDLLRGLPEAFRRTRKTALEKLVSWSG* |
| Ga0137363_116002542 | 3300012202 | Vadose Zone Soil | AGDIGRERMGEHSLVATDLVKTLPEAFRRARTAAAEKWVKIGYKMGG* |
| Ga0137399_103923771 | 3300012203 | Vadose Zone Soil | GDVMRESRGEHSLVATDLLEGLPEAFRRTRQAAQERFVRWGA* |
| Ga0137380_101639484 | 3300012206 | Vadose Zone Soil | RESRGEHSLLATDLLEGLPEAFRRTWQAAQEKFVRWGA* |
| Ga0137377_100380471 | 3300012211 | Vadose Zone Soil | LAGDIARETMGEQSLVATDLVRSLPQAFHRARRNAQEKLAKICG* |
| Ga0137385_111577231 | 3300012359 | Vadose Zone Soil | MRESRGEHSLLATDLLEGLPEAFRRTWQAAQEKFVRWGA* |
| Ga0137398_100227747 | 3300012683 | Vadose Zone Soil | AGDVKRETMGEHSLVATDLLLGLPEAFRRTRHAAQQNWVSW* |
| Ga0137419_109823151 | 3300012925 | Vadose Zone Soil | GLAGDVMRESVGEHSLVATDLLLGLPEAFQRTREGAREKLVRWNG* |
| Ga0164301_104709833 | 3300012960 | Soil | GDIARESMGEHSLVATDLVNALPAAFRRTREAAAETFSYIQAQP* |
| Ga0163162_105624053 | 3300013306 | Switchgrass Rhizosphere | GDIARESMGEHSLVATDLLKALPEAFRRAREAAAERFSYIQAQP* |
| Ga0182024_127530131 | 3300014501 | Permafrost | VGEHCMVATDLLQGLPKAFRYAQQSAREKFVCWS* |
| Ga0157376_100656341 | 3300014969 | Miscanthus Rhizosphere | HGLSGDVMRERVGEHSLVATDLLLGLPDAFARALGTAQKKFVGWDG* |
| Ga0187802_103429072 | 3300017822 | Freshwater Sediment | MRESVGDHSMVATDLLRGVPEAFRRAQRTAREKFVRWDG |
| Ga0187853_103801841 | 3300017940 | Peatland | RVGEHSLVATDLLRGLPEAFRRTQNAAKENLVGWDG |
| Ga0187819_103869051 | 3300017943 | Freshwater Sediment | ESVGEHSLVATDLLKALPEAFLRARKSAQEEIVQWEG |
| Ga0187779_106612422 | 3300017959 | Tropical Peatland | HGLAGDVMRESVGEHSMVATDLLRGLPEAFQRARGTAQEKFVRWDG |
| Ga0187783_107162311 | 3300017970 | Tropical Peatland | DVMRKHVGEHSMVATDLLTGLPEAFFATRQAAREKFVRLGA |
| Ga0187780_109815222 | 3300017973 | Tropical Peatland | VGEHSLVATDLLRGLPDAFERARATAENHFVGWEG |
| Ga0187855_102867841 | 3300018038 | Peatland | DVARETVGEHSMVATDLLQGLPEAFRRTRKTALEKLVSWSG |
| Ga0187887_105483792 | 3300018043 | Peatland | RESVGEHSMVATDLLRGLPEAFRRARHASKETLVSWEG |
| Ga0187887_106830112 | 3300018043 | Peatland | VMREIVGEHSLVATDLLKGLPDAFRRTREMAEEKPVRW |
| Ga0187890_103160232 | 3300018044 | Peatland | DVMRETVGEHSMVATDLLLGLPAAFRRTRKTALEKWVSWSG |
| Ga0187771_106786013 | 3300018088 | Tropical Peatland | VGEHSLVATDLLRGLPDAFESVRRTAREKFVCWEG |
| Ga0187770_105891512 | 3300018090 | Tropical Peatland | MREGVGEHAMVATDLVRGLPEAFRRTQATAREKFVCW |
| Ga0187770_116243782 | 3300018090 | Tropical Peatland | AGDVMREIVGEHSLVATDLLRALPDAFERARRTASEKFVCWEG |
| Ga0210407_104651372 | 3300020579 | Soil | LAGDVARETVGEHSMVATDLLRGLPEAFRRTRKTALEKLVSWSG |
| Ga0210400_102253711 | 3300021170 | Soil | AGDVTRETVGEHSLVATDLLRGLPAAFERARQSATAENSVIG |
| Ga0210405_106107321 | 3300021171 | Soil | GLAGDVMRESVGEHSMVATDLLRGLPEAFLHAQKTAREKFVGWNG |
| Ga0210387_102116551 | 3300021405 | Soil | DVARETVGEHSMVATDLLRGLPEAFRRTRKTALEKLVSWSG |
| Ga0210391_113150531 | 3300021433 | Soil | DCVGEHSLVATDLLRGLPQAFQRAREASREKLARWSG |
| Ga0210402_102817861 | 3300021478 | Soil | AGDVMRESVGEHSMVATDLLRGLPEAFQRARQTAREKFVRWEG |
| Ga0210402_107702761 | 3300021478 | Soil | DVMRETVGEHSMVATDLLQGLPEAFRRTRDTALEKFVSWSG |
| Ga0210410_108096661 | 3300021479 | Soil | LAGDVMRECRGEHSLVATDLLEGLPEAFRRTWQAAAEKFVSWGA |
| Ga0212123_101789762 | 3300022557 | Iron-Sulfur Acid Spring | RERVGEHSLVATDLLRGLPEAFRRTQNAAKENLVGWDG |
| Ga0242654_102131132 | 3300022726 | Soil | GDVVRESVGEHSMVATDLLQGLPQAFRRVERTARRNFVCWGG |
| Ga0224564_10754581 | 3300024271 | Soil | GLAGDVMRESVGEHSLIATDLLQGLPGAFRRTREAAKENLVCWGD |
| Ga0207658_115048032 | 3300025986 | Switchgrass Rhizosphere | DIARESMGEHSLVATDLVKALPPAFRRTREAAAERFSYIQAQP |
| Ga0209863_102544201 | 3300026281 | Prmafrost Soil | SAGDVMRESVGELPLVATDLLQGLPEGLRRTRRDAEGKIVRWDG |
| Ga0209648_102036814 | 3300026551 | Grasslands Soil | MRERRGEHSLVATDLLEGLPEAFRRTWQAAQEKFVGWGA |
| Ga0179587_109787991 | 3300026557 | Vadose Zone Soil | GDVMRESVGEHSLVATDLLQGLPEAFERTREAARQGLVSW |
| Ga0208732_10284032 | 3300026984 | Forest Soil | HLHGLAGDVMKAIVGEHSMVATDLLQGLPVAYRVMRQAAHDKLVRW |
| Ga0209220_10037136 | 3300027587 | Forest Soil | DVMRESRGEHSLVATDLLEGLPEAFRRTWQAAQEKFVRWGT |
| Ga0209221_11356092 | 3300027609 | Forest Soil | GDVMRESVGEHSLVATDLLKGLAQAFRRTQNAAEEKLVCWGG |
| Ga0209007_11321621 | 3300027652 | Forest Soil | HGLAGDVMREQVGEHSLVATDLLQGLPEAFRRTQNAEQEKLAGW |
| Ga0209908_101223541 | 3300027745 | Thawing Permafrost | MRESVGENSLVATDLLKGLPEAFRRTQRAEKEKLVRLSG |
| Ga0209060_101302652 | 3300027826 | Surface Soil | VGEHSMVATELLRGLPGAFRRAQQTARETFVRWDG |
| Ga0209180_106243011 | 3300027846 | Vadose Zone Soil | LHGLAGDTMRESVGEHSLVATDLLRGLASAFERTREAAQQDLVSL |
| Ga0209380_103241711 | 3300027889 | Soil | GLAGDVMRETVGEQSLVATDLLRGLPEAFRRAQKAAAEKFVRWDG |
| Ga0209624_108301642 | 3300027895 | Forest Soil | VMRESVGEYSLVATDLLQGLPEAFRRVWKASQEKLTRW |
| Ga0209067_103738172 | 3300027898 | Watersheds | VGEHSLVATDLLRGLPDAFQHAQKAALEKFVRWNG |
| Ga0209698_107947312 | 3300027911 | Watersheds | HGLAGDVMRESVGEHSMVATDLLRGLPEAFWRAQRTAREKFVRWDG |
| Ga0265356_10344522 | 3300028017 | Rhizosphere | GLAGDVMAEGMGEHSMIATDLLQGLPKAFRRAQQSAREKFVCWGG |
| Ga0302156_102544881 | 3300028748 | Bog | GDVMRERVGEHSLVATDLLLGLPEAFKRAREAASDKLVSW |
| Ga0302224_100672024 | 3300028759 | Palsa | DVMRESVGEHSLVATDLLKGLPEAFRRTREMAEEKPVRW |
| Ga0222749_107645632 | 3300029636 | Soil | MRESVGEHSLVATDLLRGLPEAFWRAQKTAQEKFVRWDG |
| Ga0311329_101742323 | 3300029907 | Bog | IREKVGEHSLIATDLLLGLPGAFLRTDKMAREKLVSWSS |
| Ga0311369_101551721 | 3300029910 | Palsa | RETVGEHSMIATDLLTGLPEAFRRAQRAAGEKSVRWDG |
| Ga0311340_100451451 | 3300029943 | Palsa | HGLAGDVMRETVGEHSMVATDLLKGLPEAFRRARKTALEKLVSWSG |
| Ga0311340_111660631 | 3300029943 | Palsa | LAGDVMRESVGEHSMVATDLLRGLPEAFRRAQKAAQEKFVRWGG |
| Ga0311372_119940771 | 3300030520 | Palsa | VIRERVGEHSLVATDLLEGLPEAFRRTREMAEETLVHW |
| Ga0265460_107335572 | 3300030740 | Soil | LETVGEHSMVATDLLQELPEAFRRTRKTALEKLVSWSG |
| Ga0265461_136099252 | 3300030743 | Soil | RETVGEHSMVATDLLRGLPEAFRRAQRAAKETLVSWGG |
| Ga0265763_10154132 | 3300030763 | Soil | GDVMRERVGEHSLVATDLLQGMPAAFRRTLQAAREKLVCW |
| Ga0170834_1034746452 | 3300031057 | Forest Soil | SVGEHSMVATDLLRGLPEAFRHAQRTALEKFVCWDG |
| Ga0265760_100045866 | 3300031090 | Soil | ETVGEHSMVATDLLRGLPEAFRRTRKTALEKLVSWSG |
| Ga0170824_1110147003 | 3300031231 | Forest Soil | HLHGLAGDVMRESVGEHSLVATDLLQGLPGAFEGTREAARQGLVRW |
| Ga0310686_1062162561 | 3300031708 | Soil | HLHGLAGDVMKAIVGEHSMVATDLLQGLPVAYRVMRQAAQDKLVRW |
| Ga0307477_104405962 | 3300031753 | Hardwood Forest Soil | GDVMRETLGEHSLVATDLLRGLPAAFERARQSATAENSAIG |
| Ga0310912_110120392 | 3300031941 | Soil | MSEIGGEHSLVATDLLRGLSDAFERARSASRESLISL |
| Ga0308176_113878091 | 3300031996 | Soil | DVMREIVGEHSLVATDLLRGLPGAFAGARKAAGEQVVCWRS |
| Ga0335079_113409752 | 3300032783 | Soil | GDVMRDKLGEHSLVATDLLKGLPEAFRRARQDAQSKLVCWTG |
| Ga0335080_123127311 | 3300032828 | Soil | EIVGEHSLVATDLLRGLPDAFARARRAAENGFVGWNS |
| Ga0335072_105250711 | 3300032898 | Soil | SVGEHSMTATDLLQGLPEAFFRAQKTAHEKAFHWEG |
| Ga0335073_103120731 | 3300033134 | Soil | MRERVGEHSMVATDLLLGLPEAFRRAREKAKVRSICF |
| Ga0334854_019810_1493_1627 | 3300033829 | Soil | LAGNVMRESVGEHSMVATDLLRGLPQAFRRTQNAAKEKLVCWGA |
| ⦗Top⦘ |