


| Basic Information | |
|---|---|
| Family ID | F097618 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MGEEKLEKRFEEVEVRCDICRKTFPLSEEGKKCPECQIGRLWLMDKAA |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.77 % |
| % of genes near scaffold ends (potentially truncated) | 35.58 % |
| % of genes from short scaffolds (< 2000 bps) | 71.15 % |
| Associated GOLD sequencing projects | 64 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.615 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (14.423 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (31.731 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 64.58% β-sheet: 0.00% Coil/Unstructured: 35.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF06723 | MreB_Mbl | 34.62 |
| PF05670 | NFACT-R_1 | 9.62 |
| PF04349 | MdoG | 4.81 |
| PF00472 | RF-1 | 2.88 |
| PF02588 | YitT_membrane | 1.92 |
| PF05036 | SPOR | 1.92 |
| PF08367 | M16C_assoc | 1.92 |
| PF02633 | Creatininase | 0.96 |
| PF00535 | Glycos_transf_2 | 0.96 |
| PF01970 | TctA | 0.96 |
| PF08338 | DUF1731 | 0.96 |
| PF04055 | Radical_SAM | 0.96 |
| PF00085 | Thioredoxin | 0.96 |
| PF02653 | BPD_transp_2 | 0.96 |
| PF13419 | HAD_2 | 0.96 |
| PF10035 | DUF2179 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 34.62 |
| COG1293 | Ribosome quality control (RQC) protein RqcH, Rqc2/NEMF/Tae2 family, contains fibronectin-(FbpA) and RNA- (NFACT) binding domains | Translation, ribosomal structure and biogenesis [J] | 9.62 |
| COG3131 | Periplasmic glucan biosynthesis protein OpgG | Cell wall/membrane/envelope biogenesis [M] | 4.81 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 2.88 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 2.88 |
| COG1284 | Uncharacterized membrane-anchored protein YitT, contains DUF161 and DUF2179 domains | Function unknown [S] | 1.92 |
| COG2364 | Uncharacterized membrane protein YczE | Function unknown [S] | 1.92 |
| COG1026 | Zn-dependent peptidase, M16 (insulinase) family | Posttranslational modification, protein turnover, chaperones [O] | 1.92 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.96 |
| COG1784 | TctA family transporter | General function prediction only [R] | 0.96 |
| COG3333 | TctA family transporter | General function prediction only [R] | 0.96 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.62 % |
| Unclassified | root | N/A | 40.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000786|WSSedA2C2DRAFT_1008108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 895 | Open in IMG/M |
| 3300002961|JGI11641J44799_10054155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1152 | Open in IMG/M |
| 3300003432|JGI20214J51088_10016210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5017 | Open in IMG/M |
| 3300003910|JGI26437J51864_10000119 | All Organisms → cellular organisms → Bacteria | 22983 | Open in IMG/M |
| 3300004066|Ga0055484_10032314 | Not Available | 1076 | Open in IMG/M |
| 3300004481|Ga0069718_16146228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 926 | Open in IMG/M |
| 3300005145|Ga0068713_1001817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 25245 | Open in IMG/M |
| 3300005145|Ga0068713_1193753 | Not Available | 566 | Open in IMG/M |
| 3300005216|Ga0068994_10013062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1577 | Open in IMG/M |
| 3300005216|Ga0068994_10030537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1157 | Open in IMG/M |
| 3300005216|Ga0068994_10093490 | Not Available | 763 | Open in IMG/M |
| 3300005252|Ga0068712_1056145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1656 | Open in IMG/M |
| 3300005252|Ga0068712_1152668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 755 | Open in IMG/M |
| 3300005254|Ga0068714_10004468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 15668 | Open in IMG/M |
| 3300005254|Ga0068714_10020679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4708 | Open in IMG/M |
| 3300005254|Ga0068714_10038239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 2921 | Open in IMG/M |
| 3300005254|Ga0068714_10117413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1265 | Open in IMG/M |
| 3300005254|Ga0068714_10353517 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005832|Ga0074469_10258941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 37557 | Open in IMG/M |
| 3300005832|Ga0074469_11092555 | Not Available | 1007 | Open in IMG/M |
| 3300006224|Ga0079037_100017319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4955 | Open in IMG/M |
| 3300006224|Ga0079037_100040918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3535 | Open in IMG/M |
| 3300006224|Ga0079037_100408116 | Not Available | 1287 | Open in IMG/M |
| 3300006224|Ga0079037_102504079 | Not Available | 514 | Open in IMG/M |
| 3300006930|Ga0079303_10409290 | Not Available | 576 | Open in IMG/M |
| 3300007072|Ga0073932_1010960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7633 | Open in IMG/M |
| 3300009009|Ga0105105_10061478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1725 | Open in IMG/M |
| 3300009053|Ga0105095_10009758 | All Organisms → cellular organisms → Bacteria | 5182 | Open in IMG/M |
| 3300009078|Ga0105106_10011764 | All Organisms → cellular organisms → Bacteria | 6363 | Open in IMG/M |
| 3300009078|Ga0105106_10540276 | Not Available | 837 | Open in IMG/M |
| 3300009078|Ga0105106_10888400 | Not Available | 634 | Open in IMG/M |
| 3300009091|Ga0102851_10151452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 2110 | Open in IMG/M |
| 3300009091|Ga0102851_12621269 | Not Available | 578 | Open in IMG/M |
| 3300009111|Ga0115026_10131931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1580 | Open in IMG/M |
| 3300009111|Ga0115026_10452714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 943 | Open in IMG/M |
| 3300009131|Ga0115027_10294122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1089 | Open in IMG/M |
| 3300009166|Ga0105100_10343771 | Not Available | 898 | Open in IMG/M |
| 3300009167|Ga0113563_11999706 | Not Available | 692 | Open in IMG/M |
| 3300009179|Ga0115028_10150322 | Not Available | 1408 | Open in IMG/M |
| 3300009179|Ga0115028_10194272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1277 | Open in IMG/M |
| 3300009179|Ga0115028_11293687 | Not Available | 606 | Open in IMG/M |
| 3300009504|Ga0114946_10020061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4014 | Open in IMG/M |
| 3300009504|Ga0114946_10133771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1367 | Open in IMG/M |
| 3300009581|Ga0115600_1153215 | Not Available | 830 | Open in IMG/M |
| 3300010412|Ga0136852_11489560 | Not Available | 641 | Open in IMG/M |
| 3300010413|Ga0136851_10162579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 2325 | Open in IMG/M |
| 3300011408|Ga0137460_1096768 | Not Available | 581 | Open in IMG/M |
| 3300012152|Ga0137347_1019300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 982 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10292536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 947 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10021035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7463 | Open in IMG/M |
| 3300017960|Ga0180429_10749198 | Not Available | 659 | Open in IMG/M |
| 3300018029|Ga0187787_10277651 | Not Available | 621 | Open in IMG/M |
| 3300018065|Ga0180430_10944051 | Not Available | 601 | Open in IMG/M |
| 3300018068|Ga0184636_1064669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1216 | Open in IMG/M |
| 3300019252|Ga0172286_1341341 | Not Available | 544 | Open in IMG/M |
| 3300020074|Ga0194113_10433296 | Not Available | 958 | Open in IMG/M |
| 3300020222|Ga0194125_10449707 | Not Available | 801 | Open in IMG/M |
| 3300022185|Ga0079039_1553999 | Not Available | 873 | Open in IMG/M |
| 3300022554|Ga0212093_1031914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3434 | Open in IMG/M |
| 3300024056|Ga0124853_1376071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1930 | Open in IMG/M |
| 3300025135|Ga0209498_1003721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 9056 | Open in IMG/M |
| 3300025948|Ga0210088_1005062 | Not Available | 1993 | Open in IMG/M |
| 3300025948|Ga0210088_1078164 | Not Available | 535 | Open in IMG/M |
| 3300025950|Ga0210134_1002354 | Not Available | 2844 | Open in IMG/M |
| 3300025964|Ga0210127_1004444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1556 | Open in IMG/M |
| 3300026463|Ga0256815_1028481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 651 | Open in IMG/M |
| 3300026476|Ga0256808_1001194 | Not Available | 2258 | Open in IMG/M |
| 3300026501|Ga0256806_1003441 | All Organisms → cellular organisms → Bacteria | 2228 | Open in IMG/M |
| 3300027536|Ga0209163_1000248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 125551 | Open in IMG/M |
| 3300027690|Ga0209164_1003356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 15295 | Open in IMG/M |
| 3300027690|Ga0209164_1023719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3509 | Open in IMG/M |
| 3300027690|Ga0209164_1108279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1078 | Open in IMG/M |
| 3300027690|Ga0209164_1117001 | Not Available | 1016 | Open in IMG/M |
| 3300027713|Ga0209286_1035916 | Not Available | 1851 | Open in IMG/M |
| 3300027731|Ga0209592_1131515 | Not Available | 904 | Open in IMG/M |
| 3300027811|Ga0256868_10192568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 871 | Open in IMG/M |
| 3300027818|Ga0209706_10399251 | Not Available | 639 | Open in IMG/M |
| 3300027871|Ga0209397_10285174 | Not Available | 786 | Open in IMG/M |
| 3300027877|Ga0209293_10062966 | Not Available | 1569 | Open in IMG/M |
| 3300027877|Ga0209293_10390617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 719 | Open in IMG/M |
| 3300027885|Ga0209450_10000101 | All Organisms → cellular organisms → Bacteria | 49088 | Open in IMG/M |
| 3300027887|Ga0208980_10068130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2075 | Open in IMG/M |
| 3300027887|Ga0208980_10426937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 763 | Open in IMG/M |
| 3300027890|Ga0209496_10094686 | Not Available | 1264 | Open in IMG/M |
| 3300027900|Ga0209253_10443353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 978 | Open in IMG/M |
| 3300027979|Ga0209705_10008679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5517 | Open in IMG/M |
| 3300029827|Ga0134606_10002067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 8699 | Open in IMG/M |
| 3300031577|Ga0316602_10038059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 761 | Open in IMG/M |
| 3300031834|Ga0315290_10746896 | Not Available | 840 | Open in IMG/M |
| 3300032163|Ga0315281_10341926 | Not Available | 1624 | Open in IMG/M |
| 3300033406|Ga0316604_10526857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 650 | Open in IMG/M |
| 3300033413|Ga0316603_12367590 | Not Available | 500 | Open in IMG/M |
| 3300033414|Ga0316619_10772169 | Not Available | 818 | Open in IMG/M |
| 3300033416|Ga0316622_101054642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 949 | Open in IMG/M |
| 3300033418|Ga0316625_100061407 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
| 3300033418|Ga0316625_100749024 | Not Available | 829 | Open in IMG/M |
| 3300033419|Ga0316601_100094653 | All Organisms → cellular organisms → Bacteria | 2393 | Open in IMG/M |
| 3300033481|Ga0316600_10001759 | All Organisms → cellular organisms → Bacteria | 9832 | Open in IMG/M |
| 3300033481|Ga0316600_11074991 | Not Available | 570 | Open in IMG/M |
| 3300033482|Ga0316627_101063415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4 | 790 | Open in IMG/M |
| 3300033483|Ga0316629_11063819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 639 | Open in IMG/M |
| 3300033485|Ga0316626_10286901 | Not Available | 1334 | Open in IMG/M |
| 3300033485|Ga0316626_10295103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1317 | Open in IMG/M |
| 3300033513|Ga0316628_101576064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 875 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 14.42% |
| Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 13.46% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 11.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 9.62% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 8.65% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 7.69% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 4.81% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.88% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.88% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 2.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.92% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.92% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.92% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.92% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.92% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.92% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.92% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 1.92% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.96% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.96% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000786 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A2 Cattail | Environmental | Open in IMG/M |
| 3300002961 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003910 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW | Environmental | Open in IMG/M |
| 3300004066 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005145 | Enrichment culture microbial communities om Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS2 (Arthur Kill Sulfidogenic replicate 2) MetaG | Engineered | Open in IMG/M |
| 3300005216 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300005252 | Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS1 (Arthur Kill Sulfidogenic replicate 1) MetaG | Engineered | Open in IMG/M |
| 3300005254 | Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG | Engineered | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300007072 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaG | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
| 3300009581 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300011408 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT723_2 | Environmental | Open in IMG/M |
| 3300012152 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2 | Environmental | Open in IMG/M |
| 3300013136 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300017960 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_1 metaG | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018065 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaG | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300019252 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300022185 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022554 | Dewar_combined assembly | Environmental | Open in IMG/M |
| 3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025135 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes) | Environmental | Open in IMG/M |
| 3300025948 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025950 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025964 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026463 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS6 | Environmental | Open in IMG/M |
| 3300026476 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR6 | Environmental | Open in IMG/M |
| 3300026501 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR4 | Environmental | Open in IMG/M |
| 3300027536 | Enrichment culture microbial communities om Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS2 (Arthur Kill Sulfidogenic replicate 2) MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027690 | Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027731 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027811 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300029827 | Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047 | Environmental | Open in IMG/M |
| 3300031577 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| WSSedA2C2DRAFT_10081081 | 3300000786 | Wetland | MGEEKLEKRFEEVEVRCDICRKTFPLSEEGKKCPECQIGRLW |
| JGI11641J44799_100541553 | 3300002961 | Wetland | MGEEKLEKRFEEVEVRCDICRKTFPLSEEGKKCPECQIGRLWLMDKAA* |
| JGI20214J51088_100162103 | 3300003432 | Wetland | MGEEKLEKRFEEAEVRCDVCRKTFPLSEEGKKCPECQIGRLWLMDKAA* |
| JGI26437J51864_1000011914 | 3300003910 | Freshwater Lake Sediment | MAEENLEKRFEEVEVRCDICRKTFPLSQEGKKCPECQIGRLWLMDKAA* |
| Ga0055484_100323141 | 3300004066 | Natural And Restored Wetlands | MGEEKLEKRFEEAEVRCDICRKTFPLSEEGKKCPECQIGRLWLMDKAA* |
| Ga0069718_161462282 | 3300004481 | Sediment | MGEEKLEKRFEEAEVRCDVCRKTFPLSEEGKKCPQCQIGR |
| Ga0068713_10018174 | 3300005145 | Enrichment Culture | MSEEKAQKLTEDMEVRCDVCRKTFPPSEEGKRCPECGIGRIWSMQKAA* |
| Ga0068713_11937531 | 3300005145 | Enrichment Culture | MGEEKREKSFEDMEVRCDVCRKTFPLSEEGKRCPECNIGRLWLMDKAA* |
| Ga0068994_100130622 | 3300005216 | Natural And Restored Wetlands | MGEENLEKRFEEVEVRCDICRKTFPLSEEGKKCPECQIGRLWLMEKAA* |
| Ga0068994_100305371 | 3300005216 | Natural And Restored Wetlands | MGEEKREKGFEGMEVRCDVCRKTFPLSEEGKRCPECNIGRLWLMDKAA* |
| Ga0068994_100934901 | 3300005216 | Natural And Restored Wetlands | MGEEKREKGFEDMEVRCDVCRKTFPLSEEGKRCPECNIGRLWLMDKAA* |
| Ga0068712_10561453 | 3300005252 | Enrichment Culture | MGEEKREKGFEDMEVRCDVCRKTFPLSEEGKRCPACNIGRLWLMDKAA* |
| Ga0068712_11526681 | 3300005252 | Enrichment Culture | MSEERAEKLAEGMEVRCDVCRKTFPLSEAGKQCPECGIGRIW |
| Ga0068714_1000446810 | 3300005254 | Enrichment Culture | MSEERAERLAEATEVRCDVCRKVFPPSEEGRKCPECGIGRLWLMEKAA* |
| Ga0068714_100206793 | 3300005254 | Enrichment Culture | MEEERAARLTEDSEVRCDVCRKTFPPSEQGKQCPECRIGRLWLMEKAA* |
| Ga0068714_100382393 | 3300005254 | Enrichment Culture | MSEEKAQKLAEDMEVRCDVCRKTFPPSEEGKRCPECGIGRIWSMEKAA* |
| Ga0068714_101174131 | 3300005254 | Enrichment Culture | MGEEKREKGFENMEVRCDVCRKTFPLSEEGKRCPECNIGRLWLMDKAA* |
| Ga0068714_103535171 | 3300005254 | Enrichment Culture | MSEERAASGSENTEVRCDVCRKTFPAEEQGKQCPECKIGRLWLMEKAVS* |
| Ga0074469_1025894122 | 3300005832 | Sediment (Intertidal) | MGEEKLEKRFEAMEVRCDVCRKTFPLSEEGKKCPECQIGRLWLMDKAA* |
| Ga0074469_110925551 | 3300005832 | Sediment (Intertidal) | HMSEERAEKFAENMEVRCDVCRKIFPASEEGKRCPECGIGRIWLMEKAA* |
| Ga0079037_1000173198 | 3300006224 | Freshwater Wetlands | MGEEKLEKRFEDTEVRCDICRKTFPLSEEGKKCPECHIGRLWLMDKAA* |
| Ga0079037_1000409182 | 3300006224 | Freshwater Wetlands | MGEQKLEKRFEEVEVRCDICRKIFPLSEEGKKCPECQIGRLWLMDKAA* |
| Ga0079037_1004081161 | 3300006224 | Freshwater Wetlands | LEKRFEEVEVRCDICRKTFPLSQEGKKCPECQIGRLWLMDKAA* |
| Ga0079037_1025040791 | 3300006224 | Freshwater Wetlands | SFSSSLTRRLAMGEEKLEKRFEELEVRCDICRKTFPLSEEGKKCPECQIGRLWLMDKAA* |
| Ga0079303_104092901 | 3300006930 | Deep Subsurface | MGEQKLEKRFEEVEVRCDICRKTFPLSEEGKKCPECQIGRLWLMDKAA* |
| Ga0073932_10109608 | 3300007072 | Hot Spring Sediment | MGDEKREKGFENMEVRCDVCRKTFPLSEEGKRCPECNIGRLWLMDKAA* |
| Ga0105105_100614783 | 3300009009 | Freshwater Sediment | MGEEKLEKRFEEAEVRCDVCRKTFPLSEEGKKCPQCQIGRLWLMEKAA* |
| Ga0105095_100097583 | 3300009053 | Freshwater Sediment | VSLLSLNLYKRRLAMGEEKLEKRFEEAEVRCDVCRKTFPLSEEGKKCPQCQIGRLWLMEKAA* |
| Ga0105106_100117641 | 3300009078 | Freshwater Sediment | IAVPLFKKLSPVSLLSLNLYKRRLAMGEEKLEKRFEEAEVRCDVCRKTFPLSEEGKKCPQCQIGRLWLMEKAA* |
| Ga0105106_105402761 | 3300009078 | Freshwater Sediment | MGEEKLEKRFEAMEVRCDICRKTFPLSEEGKKCPECHLGRLWLMDKAA* |
| Ga0105106_108884001 | 3300009078 | Freshwater Sediment | MGEEKLEKRFEDMEVRCDICRKIFPLSEEGKKCPECHIGCLWLMDKAA* |
| Ga0102851_101514522 | 3300009091 | Freshwater Wetlands | MAEEKLEKRFEEVEVRCDICRKTFPLSQEGKKCPECQIGRLWLMDKAA* |
| Ga0102851_126212691 | 3300009091 | Freshwater Wetlands | MAEENLEKRFEEVEVRCDICRKTFPLSEEGKKCPECQIGRLWLMDKAA* |
| Ga0115026_101319313 | 3300009111 | Wetland | MGEEKLEKRFEELEVRCDICRKTFPLSEEGKKCPECQIGRLWLMDKAA* |
| Ga0115026_104527143 | 3300009111 | Wetland | MGEEKLEKRFEDTEVRCDICRKTFPLSEEGKKCPECHIGRLWLMDKAP* |
| Ga0115027_102941221 | 3300009131 | Wetland | MGEEKLEKRFEEAEVRCDICRKTFPLSEEGKKCPECQIG |
| Ga0105100_103437711 | 3300009166 | Freshwater Sediment | LAVGEEKLEKRFEDLEVRCDICRKTFPLSEEGKKCPECNIGRLWLMDKAA* |
| Ga0113563_119997061 | 3300009167 | Freshwater Wetlands | VSLLSLDLYKRRLAMGEEKLEKRFEEAEVRCDVCRKTFPLSEEGKKCPECQIGRLWLMDKAA* |
| Ga0115028_101503222 | 3300009179 | Wetland | MGEEKLEKRFEELEVRCDICRKTFPLSEEGKKCPECHIGRLWLMDKAP* |
| Ga0115028_101942721 | 3300009179 | Wetland | MGEEKLEKRFEDTEVRCDICRKTFPLSQEGKKCPECQIGR |
| Ga0115028_112936872 | 3300009179 | Wetland | VSSFSSSLTRRSAMGEEKLEKRFEEVEVRCDICRKTFPLSEEGKKCPECQIGRLWLMDKAA* |
| Ga0114946_100200613 | 3300009504 | Sediment | MEEERAARRTEDSEVRCDVCRKTFPPSEQGKQCPECRIGRLWLMEKAA* |
| Ga0114946_101337713 | 3300009504 | Sediment | MSEEREATRAEDMEVRCDVCRKSFPPSEQGKQCPD |
| Ga0115600_11532151 | 3300009581 | Wetland | VSSYSSSPTRRLAMAEEKLEKRFEEVEVRCDICRKTFPLSQEGKKCPECQIGRLWLMDKAA* |
| Ga0136852_114895602 | 3300010412 | Mangrove Sediment | SFSSSLPRRFAMGEEKREKGFEDMEVRCDVCRKTFPLSEEGKRCPACNIGRLWLMDKAA* |
| Ga0136851_101625792 | 3300010413 | Mangrove Sediment | MGQEKLEKRLEAVEVRCDVCRKTFPLSEEGKKCPECQIGRLWLMDKAA* |
| Ga0137460_10967682 | 3300011408 | Soil | MGEEKLEKRFEDLEVRCDLCRKTFPLYEAGKKCPECNIGRLWLMDKAA* |
| Ga0137347_10193002 | 3300012152 | Soil | MGEEKLEKRFEDLEVRCDICRKTFPLSEEGKECPECNIGRLWLMDKAA* |
| (restricted) Ga0172370_102925361 | 3300013136 | Freshwater | MGEEKLEKRFEEVEVRCDVCRKTYPLSEEGKRCPECQIGRLWLMEKAA* |
| (restricted) Ga0172375_100210355 | 3300013137 | Freshwater | MGEEKLEKRFEEVEVRSDVCRKTYPLSEEGKRCPECQIGRLWLMEKAA* |
| Ga0180429_107491981 | 3300017960 | Hypersaline Lake Sediment | DMEVRCDVCRKTFPPSEQGKQCPECRIGRLWLMEKAA |
| Ga0187787_102776512 | 3300018029 | Tropical Peatland | MGEEKLEKRFEEVEVRCDICRKTFPLSEEGKKCPECQIGRLWLMDKAA |
| Ga0180430_109440511 | 3300018065 | Hypersaline Lake Sediment | MNEERAARHAEDMEVRCDVCRKTFPPSEQGKQCPECRIGRLWLMEKAA |
| Ga0184636_10646693 | 3300018068 | Groundwater Sediment | MGEEKLEKRFEDLEVRCDICRKTFPLSEEGKECPECNIGRLWLMDKAA |
| Ga0172286_13413411 | 3300019252 | Wetland | GVSSFSSSLTRRLAMGEQKLEKRFEEVEVRCDICRKIFPLSEEGKKCPECQIGRLWLMDKAA |
| Ga0194113_104332961 | 3300020074 | Freshwater Lake | MGKEKEQKNLEGMEVRCDVCRKTFPVSEEGKKCPDCGIGRLWLMEKAA |
| Ga0194125_104497071 | 3300020222 | Freshwater Lake | MGKEKEQKNLEGMEVRCDVCRKTFTLSEEGKKCPDCGIGRLWLMEKAA |
| Ga0079039_15539991 | 3300022185 | Freshwater Wetlands | SSPTRRLAMAEEKLEKRFEEVEVRCDICRKTFPLSQEGKKCPECQIGRLWLMDKAA |
| Ga0212093_10319146 | 3300022554 | Hot Spring Sediment | MGDEKREKGFENMEVRCDVCRKTFPLSEEGKRCPECNIGRLWLMDKAA |
| Ga0124853_13760712 | 3300024056 | Freshwater Wetlands | MGEQKLEKRFEEVEVRCDICRKIFPLSEEEKVPECQIGRLWLMDKAA |
| Ga0209498_10037213 | 3300025135 | Sediment | MEEERAARRTEDSEVRCDVCRKTFPPSEQGKQCPECRIGRLWLMEKAA |
| Ga0210088_10050623 | 3300025948 | Natural And Restored Wetlands | MGEEKLEKRFEEAEVRCDICRKTFPLSEEGKKCPECQIGRLWLMDKAA |
| Ga0210088_10781643 | 3300025948 | Natural And Restored Wetlands | MGEEKREKGFEGMEVRCDVCRKTFPLSEEGKRCPECNIGRLWLMDKAA |
| Ga0210134_10023542 | 3300025950 | Natural And Restored Wetlands | MGEEKLEKRFEAMEVRCDVCRKTFPLSEEGKKCPECQIGRLWLMDKAA |
| Ga0210127_10044441 | 3300025964 | Natural And Restored Wetlands | MGEEKLEKRFEAMEVRCDVCRKTFPLSEEGKRCPECNIGRLWLMDKAA |
| Ga0256815_10284813 | 3300026463 | Sediment | MGEEKLEKRFEDVEVRCDICRKTFPLSEEGKKCPECGIGRLWLMDKAA |
| Ga0256808_10011944 | 3300026476 | Sediment | MGEEKLEKRFEEVEVRCDICRKTFPLSEEGKKCPECQLGRLWLMDKAA |
| Ga0256806_10034413 | 3300026501 | Sediment | RRLAMGEEKLEKRFEEVEVRCDICRKTFPLSEEGKKCPECQLGRLWLMDKAA |
| Ga0209163_1000248146 | 3300027536 | Enrichment Culture | MSEEKAQKLTEDMEVRCDVCRKTFPPSEEGKRCPECGIGRIWSMQKAA |
| Ga0209164_10033567 | 3300027690 | Enrichment Culture | MSEERAERLAEATEVRCDVCRKVFPPSEEGRKCPECGIGRLWLMEKAA |
| Ga0209164_10237193 | 3300027690 | Enrichment Culture | MGEEKREKGFENMEVRCDVCRKTFPLSEEGKRCPECNIGRLWLMDKAA |
| Ga0209164_11082791 | 3300027690 | Enrichment Culture | MSEEKAQKLAEDMEVRCDVCRKTFPPSEEGKRCPECGIGRIWSMEKAA |
| Ga0209164_11170013 | 3300027690 | Enrichment Culture | MGEEKREKGFEDMEVRCDVCRKTFPLSEEGKRCPACNIGRLWLMDKAA |
| Ga0209286_10359162 | 3300027713 | Freshwater Sediment | MGEEKLEKRFEEAEVRCDVCRKTFPLSEEGKKCPQCQIGRLWLMEKAA |
| Ga0209592_11315151 | 3300027731 | Freshwater Sediment | KRFEDLEVRCDICRKTFPLSEEGKKCPECNIGRLWLMDKAA |
| Ga0256868_101925683 | 3300027811 | Soil | MGEEKLEKRFEDTEVRCDICRKTFPLSEEGKKCPECHIGRLWLMD |
| Ga0209706_103992512 | 3300027818 | Freshwater Sediment | MGEEKLEKRFEAMEVRCDICRKTFPLSEEGKKCPECHLGRLWLMDKAA |
| Ga0209397_102851741 | 3300027871 | Wetland | GVSSFSSSLTRRSAMGEEKLEKRFEEVEVRCDICRKTFPLSEEGKKCPECQIGRLWLMDKAA |
| Ga0209293_100629663 | 3300027877 | Wetland | RLAMAEEKLEKRFEEVEVRCDICRKTFPLSQEGKKCPECQIGRLWLMDKAA |
| Ga0209293_103906171 | 3300027877 | Wetland | MGEEKLEKRFEDTEVRCDICRKTFPLSEEGKKCPECHIGRLWLMDKAA |
| Ga0209450_1000010144 | 3300027885 | Freshwater Lake Sediment | MAEENLEKRFEEVEVRCDICRKTFPLSQEGKKCPECQIGRLWLMDKAA |
| Ga0208980_100681304 | 3300027887 | Wetland | MEEEKLEKCFDEVEVRCDICRKTFPPSEEGKKCPECQIGRLWLMDKAA |
| Ga0208980_104269372 | 3300027887 | Wetland | MGEEKLEKRFEEVEVRCDICRKTFPLSEEGKKCPECQIGRLWLM |
| Ga0209496_100946862 | 3300027890 | Wetland | MGEEKLEKRFEDTEVRCDICRKTFPLSEEGKKCPECHIGRLWLMDKAP |
| Ga0209253_104433531 | 3300027900 | Freshwater Lake Sediment | LAVGEEKLEKRFEDLEVRCDICRKNFPLSEEGKKCPECNIGRLWLMDKAA |
| Ga0209705_100086793 | 3300027979 | Freshwater Sediment | VSLLSLNLYKRRLAMGEEKLEKRFEEAEVRCDVCRKTFPLSEEGKKCPQCQIGRLWLMEKAA |
| Ga0134606_100020677 | 3300029827 | Marine Sediment | MSEERAERLTEDTEVRCDVCRKTFPPSEEGKRCPECGIGRIWLMEKAA |
| Ga0316602_100380591 | 3300031577 | Soil | MAEENLEKRFEEVEVRCDICRKTFPLSQEGKKCPECQIGRLW |
| Ga0315290_107468962 | 3300031834 | Sediment | MGEEKLEKRFEDLEVRCDICRKNFPLSEEGKKCPECNIGRLWLMDKAA |
| Ga0315281_103419263 | 3300032163 | Sediment | LAVGEEKLEKRFEDLEVRCDICRKTFPLSEEGKKCPECNIGRLWLMDKAA |
| Ga0316604_105268573 | 3300033406 | Soil | MGEEKLEKRFEELEVRCDICRKTFPLSEEGKKCPECQIGRLWLMDKAA |
| Ga0316603_123675902 | 3300033413 | Soil | MGEEKLEKRFEEAEVRCDVCRKTFPLSEEGKKCPECQIGRLWLMDKAA |
| Ga0316619_107721692 | 3300033414 | Soil | MGEEKLEKRFEEVEVRCDICRKTFPLSEEGKKCPECHIGRLWLMDKAA |
| Ga0316622_1010546421 | 3300033416 | Soil | MAEEKLEKRFEEVEVRCDICRKTFPLSQEGKKCPECQIGRLWLMDKA |
| Ga0316625_1000614075 | 3300033418 | Soil | MGEQKLEKRFEEVEVRCDICRKIFPLSEEGKKCPECQIGRLWLMDKAA |
| Ga0316625_1007490241 | 3300033418 | Soil | LKRRFAMGEEKLEKRFEDTEVRCDICRKTFPLSEEGKKCPECHIGRLWLMDKAA |
| Ga0316601_1000946531 | 3300033419 | Soil | KRRLAMGEEKLEKRFEEVEVRCDICRKTFPLSEEGKKCPECQIGRLWLMDKAA |
| Ga0316600_100017595 | 3300033481 | Soil | MAEENLEKRFEEVEVRCDICRKTFPLSQEGKKCPVCQIGRLWLMDKAA |
| Ga0316600_110749911 | 3300033481 | Soil | RRLAMGEEKLEKRFEELEVRCDICRKTFPLSEEGKKCPECQIGRLWLMDKAA |
| Ga0316627_1010634151 | 3300033482 | Soil | RRLAMGEEKLEKRFEEAEVRCDVCRKTFPLSEEGKKCPECQIGRLWLMDKAA |
| Ga0316629_110638191 | 3300033483 | Soil | MGEEKLEKRFEEVEVRCDICRKTFPLSEEGKKCPECQIGRL |
| Ga0316626_102869012 | 3300033485 | Soil | YSSSPTRRLAMAEEKLEKRFEEVEVRCDICRKTFPLSQEGKKCPECQIGRLWLMDKAA |
| Ga0316626_102951031 | 3300033485 | Soil | MAEENLEKRFEEVEVRCDICRKTFPLSQEGKKCPECQIGRLWLMDKA |
| Ga0316628_1015760642 | 3300033513 | Soil | MEEEKLEKCYDEVEVRCDICRKTFPLSEEGKKCPECQIGRLWLMDK |
| ⦗Top⦘ |