


| Basic Information | |
|---|---|
| Family ID | F097608 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLNFYAPCEEVFV |
| Number of Associated Samples | 66 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 21.78 % |
| % of genes near scaffold ends (potentially truncated) | 56.73 % |
| % of genes from short scaffolds (< 2000 bps) | 75.00 % |
| Associated GOLD sequencing projects | 56 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.346 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (24.038 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.885 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (34.615 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.30% β-sheet: 0.00% Coil/Unstructured: 52.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00275 | EPSP_synthase | 5.77 |
| PF01618 | MotA_ExbB | 3.85 |
| PF13567 | DUF4131 | 3.85 |
| PF01326 | PPDK_N | 2.88 |
| PF02073 | Peptidase_M29 | 2.88 |
| PF01970 | TctA | 2.88 |
| PF01869 | BcrAD_BadFG | 1.92 |
| PF00581 | Rhodanese | 1.92 |
| PF00108 | Thiolase_N | 1.92 |
| PF02954 | HTH_8 | 1.92 |
| PF00113 | Enolase_C | 1.92 |
| PF05935 | Arylsulfotrans | 1.92 |
| PF00391 | PEP-utilizers | 1.92 |
| PF08240 | ADH_N | 1.92 |
| PF01098 | FTSW_RODA_SPOVE | 1.92 |
| PF01425 | Amidase | 1.92 |
| PF00072 | Response_reg | 0.96 |
| PF13191 | AAA_16 | 0.96 |
| PF09719 | C_GCAxxG_C_C | 0.96 |
| PF05402 | PqqD | 0.96 |
| PF00497 | SBP_bac_3 | 0.96 |
| PF13458 | Peripla_BP_6 | 0.96 |
| PF04199 | Cyclase | 0.96 |
| PF00293 | NUDIX | 0.96 |
| PF01116 | F_bP_aldolase | 0.96 |
| PF13792 | Obsolete Pfam Family | 0.96 |
| PF00107 | ADH_zinc_N | 0.96 |
| PF11578 | DUF3237 | 0.96 |
| PF00344 | SecY | 0.96 |
| PF04879 | Molybdop_Fe4S4 | 0.96 |
| PF02910 | Succ_DH_flav_C | 0.96 |
| PF02424 | ApbE | 0.96 |
| PF02754 | CCG | 0.96 |
| PF01627 | Hpt | 0.96 |
| PF00156 | Pribosyltran | 0.96 |
| PF13507 | GATase_5 | 0.96 |
| PF14579 | HHH_6 | 0.96 |
| PF01558 | POR | 0.96 |
| PF00378 | ECH_1 | 0.96 |
| PF00828 | Ribosomal_L27A | 0.96 |
| PF00890 | FAD_binding_2 | 0.96 |
| PF00211 | Guanylate_cyc | 0.96 |
| PF06050 | HGD-D | 0.96 |
| PF00005 | ABC_tran | 0.96 |
| PF13361 | UvrD_C | 0.96 |
| PF01135 | PCMT | 0.96 |
| PF08448 | PAS_4 | 0.96 |
| PF00285 | Citrate_synt | 0.96 |
| PF13563 | 2_5_RNA_ligase2 | 0.96 |
| PF05670 | NFACT-R_1 | 0.96 |
| PF14574 | RACo_C_ter | 0.96 |
| PF01066 | CDP-OH_P_transf | 0.96 |
| PF00542 | Ribosomal_L12 | 0.96 |
| PF09723 | Zn-ribbon_8 | 0.96 |
| PF01012 | ETF | 0.96 |
| PF00037 | Fer4 | 0.96 |
| PF02518 | HATPase_c | 0.96 |
| PF00905 | Transpeptidase | 0.96 |
| PF02738 | MoCoBD_1 | 0.96 |
| PF02508 | Rnf-Nqr | 0.96 |
| PF01797 | Y1_Tnp | 0.96 |
| PF03952 | Enolase_N | 0.96 |
| PF13237 | Fer4_10 | 0.96 |
| PF01841 | Transglut_core | 0.96 |
| PF01464 | SLT | 0.96 |
| PF07885 | Ion_trans_2 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 2.88 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 2.88 |
| COG1784 | TctA family transporter | General function prediction only [R] | 2.88 |
| COG2309 | Leucyl aminopeptidase (aminopeptidase T) | Amino acid transport and metabolism [E] | 2.88 |
| COG3333 | TctA family transporter | General function prediction only [R] | 2.88 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.92 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 1.92 |
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 1.92 |
| COG0191 | Fructose/tagatose bisphosphate aldolase | Carbohydrate transport and metabolism [G] | 0.96 |
| COG0201 | Preprotein translocase subunit SecY | Intracellular trafficking, secretion, and vesicular transport [U] | 0.96 |
| COG0222 | Ribosomal protein L7/L12 | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.96 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 0.96 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.96 |
| COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 0.96 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.96 |
| COG1293 | Ribosome quality control (RQC) protein RqcH, Rqc2/NEMF/Tae2 family, contains fibronectin-(FbpA) and RNA- (NFACT) binding domains | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG1347 | Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrD | Energy production and conversion [C] | 0.96 |
| COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG1727 | Ribosomal protein L18E | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG1775 | Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA dehydratase subunit, BcrC/BadD/HgdB | Amino acid transport and metabolism [E] | 0.96 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.96 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.96 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.96 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.96 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 0.96 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.96 |
| COG2209 | Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrE | Energy production and conversion [C] | 0.96 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.96 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG4657 | Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfA subunit | Energy production and conversion [C] | 0.96 |
| COG4660 | Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfE subunit | Energy production and conversion [C] | 0.96 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 66.35 % |
| Unclassified | root | N/A | 33.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000229|TB_LI09_3DRAFT_1004385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3797 | Open in IMG/M |
| 3300000309|WSSedA1BaDRAFT_1014098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1326 | Open in IMG/M |
| 3300000310|WSSedA1Ba2DRAFT_1033723 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300000311|WSSedA1Ba3DRAFT_1060590 | Not Available | 740 | Open in IMG/M |
| 3300001279|JGI20214J14112_1023504 | Not Available | 994 | Open in IMG/M |
| 3300001547|JGI20215J15232_1005458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1933 | Open in IMG/M |
| 3300002961|JGI11641J44799_10001393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7527 | Open in IMG/M |
| 3300002961|JGI11641J44799_10021688 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300002961|JGI11641J44799_10029022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 1634 | Open in IMG/M |
| 3300002961|JGI11641J44799_10062465 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300003432|JGI20214J51088_10002599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 11979 | Open in IMG/M |
| 3300003432|JGI20214J51088_10010098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 6269 | Open in IMG/M |
| 3300003432|JGI20214J51088_10239563 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300003541|JGI20214J51650_10005048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 8221 | Open in IMG/M |
| 3300003858|Ga0031656_10005705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 5149 | Open in IMG/M |
| 3300003859|Ga0031653_10055038 | Not Available | 1068 | Open in IMG/M |
| 3300003910|JGI26437J51864_10000516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 9916 | Open in IMG/M |
| 3300003910|JGI26437J51864_10000654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 8482 | Open in IMG/M |
| 3300004048|Ga0055494_10003531 | Not Available | 1889 | Open in IMG/M |
| 3300004050|Ga0055491_10063908 | Not Available | 852 | Open in IMG/M |
| 3300004079|Ga0055514_10046397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 927 | Open in IMG/M |
| 3300005213|Ga0068998_10106239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → Candidatus Accumulibacter aalborgensis | 632 | Open in IMG/M |
| 3300005219|Ga0069004_10053946 | Not Available | 940 | Open in IMG/M |
| 3300005832|Ga0074469_10098155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 15874 | Open in IMG/M |
| 3300006224|Ga0079037_100778329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 938 | Open in IMG/M |
| 3300006224|Ga0079037_102051661 | Not Available | 571 | Open in IMG/M |
| 3300006224|Ga0079037_102355256 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006930|Ga0079303_10006272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3382 | Open in IMG/M |
| 3300006930|Ga0079303_10348796 | Not Available | 619 | Open in IMG/M |
| 3300009078|Ga0105106_10435344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 945 | Open in IMG/M |
| 3300009087|Ga0105107_10188185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 1448 | Open in IMG/M |
| 3300009091|Ga0102851_10041849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus | 3605 | Open in IMG/M |
| 3300009091|Ga0102851_12830202 | Not Available | 557 | Open in IMG/M |
| 3300009111|Ga0115026_10058046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 2179 | Open in IMG/M |
| 3300009153|Ga0105094_10683708 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300009153|Ga0105094_10890428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300009166|Ga0105100_10249018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Bilophila | 1062 | Open in IMG/M |
| 3300009167|Ga0113563_10160851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2177 | Open in IMG/M |
| 3300009167|Ga0113563_11074112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 930 | Open in IMG/M |
| 3300009167|Ga0113563_11201165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 883 | Open in IMG/M |
| 3300009167|Ga0113563_11425551 | Not Available | 814 | Open in IMG/M |
| 3300009167|Ga0113563_13790653 | Not Available | 512 | Open in IMG/M |
| 3300009179|Ga0115028_10809583 | Not Available | 730 | Open in IMG/M |
| 3300009509|Ga0123573_10225496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1839 | Open in IMG/M |
| 3300009509|Ga0123573_11159161 | Not Available | 721 | Open in IMG/M |
| 3300010412|Ga0136852_10636770 | Not Available | 1026 | Open in IMG/M |
| 3300010413|Ga0136851_10856701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 888 | Open in IMG/M |
| 3300010413|Ga0136851_11176776 | Not Available | 742 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10019932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus | 7756 | Open in IMG/M |
| 3300018070|Ga0184631_10127457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1012 | Open in IMG/M |
| 3300018070|Ga0184631_10418002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 552 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10110711 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10111643 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → unclassified Nitrospira → Nitrospira bacterium SG8_3 | 1539 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10122017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1436 | Open in IMG/M |
| 3300025966|Ga0210105_1002215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2930 | Open in IMG/M |
| 3300027715|Ga0208665_10137723 | Not Available | 761 | Open in IMG/M |
| 3300027715|Ga0208665_10251427 | Not Available | 556 | Open in IMG/M |
| 3300027796|Ga0209373_10283151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 679 | Open in IMG/M |
| 3300027871|Ga0209397_10027521 | Not Available | 1885 | Open in IMG/M |
| 3300027877|Ga0209293_10164241 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300027877|Ga0209293_10382052 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300027887|Ga0208980_10061033 | All Organisms → cellular organisms → Bacteria | 2198 | Open in IMG/M |
| 3300027887|Ga0208980_10261995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfarculales → Desulfarculaceae | 1005 | Open in IMG/M |
| 3300027887|Ga0208980_10484850 | Not Available | 710 | Open in IMG/M |
| 3300027900|Ga0209253_10001640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 19701 | Open in IMG/M |
| 3300027979|Ga0209705_10012042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 4715 | Open in IMG/M |
| 3300031577|Ga0316602_10014679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1242 | Open in IMG/M |
| 3300031834|Ga0315290_10168605 | All Organisms → cellular organisms → Bacteria | 1891 | Open in IMG/M |
| 3300031873|Ga0315297_10215525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-21 | 1584 | Open in IMG/M |
| 3300032143|Ga0315292_10350922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1234 | Open in IMG/M |
| 3300032163|Ga0315281_10268906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1873 | Open in IMG/M |
| 3300032163|Ga0315281_10395005 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300032163|Ga0315281_11047297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 824 | Open in IMG/M |
| 3300032177|Ga0315276_10714963 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300032177|Ga0315276_11686672 | Not Available | 654 | Open in IMG/M |
| 3300032397|Ga0315287_10223654 | Not Available | 2203 | Open in IMG/M |
| 3300032401|Ga0315275_10108604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3047 | Open in IMG/M |
| 3300033408|Ga0316605_10018183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4401 | Open in IMG/M |
| 3300033408|Ga0316605_10361965 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300033408|Ga0316605_10396900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 1243 | Open in IMG/M |
| 3300033418|Ga0316625_100491523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 964 | Open in IMG/M |
| 3300033433|Ga0326726_10856380 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300033434|Ga0316613_11090892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 550 | Open in IMG/M |
| 3300033481|Ga0316600_10279191 | Not Available | 1117 | Open in IMG/M |
| 3300033481|Ga0316600_10321053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1047 | Open in IMG/M |
| 3300033482|Ga0316627_100011232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → delta proteobacterium NaphS2 | 4196 | Open in IMG/M |
| 3300033482|Ga0316627_100484904 | Not Available | 1092 | Open in IMG/M |
| 3300033483|Ga0316629_10174001 | Not Available | 1335 | Open in IMG/M |
| 3300033486|Ga0316624_10901611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 792 | Open in IMG/M |
| 3300033487|Ga0316630_10848576 | Not Available | 787 | Open in IMG/M |
| 3300033487|Ga0316630_12163539 | Not Available | 513 | Open in IMG/M |
| 3300033488|Ga0316621_10230442 | Not Available | 1176 | Open in IMG/M |
| 3300033488|Ga0316621_10688803 | Not Available | 737 | Open in IMG/M |
| 3300033489|Ga0299912_10074021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 2985 | Open in IMG/M |
| 3300033513|Ga0316628_100348717 | Not Available | 1862 | Open in IMG/M |
| 3300033513|Ga0316628_103848924 | Not Available | 538 | Open in IMG/M |
| 3300033521|Ga0316616_102437441 | Not Available | 700 | Open in IMG/M |
| 3300033557|Ga0316617_100654883 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300033557|Ga0316617_101036658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 804 | Open in IMG/M |
| 3300033557|Ga0316617_101437519 | Not Available | 693 | Open in IMG/M |
| 3300033557|Ga0316617_102682055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 518 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 24.04% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 14.42% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 9.62% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 9.62% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 5.77% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 5.77% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.77% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 4.81% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 4.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.85% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 3.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.92% |
| Wetland | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Wetland | 0.96% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.96% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.96% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000229 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_3 | Environmental | Open in IMG/M |
| 3300000309 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300000310 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300000311 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300001279 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300001547 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site C1 Bulk | Environmental | Open in IMG/M |
| 3300002961 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
| 3300003859 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR | Environmental | Open in IMG/M |
| 3300003910 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW | Environmental | Open in IMG/M |
| 3300004048 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004079 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005219 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D2 | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
| 3300024054 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG | Environmental | Open in IMG/M |
| 3300025966 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
| 3300027796 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300031577 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB_LI09_3DRAFT_10043852 | 3300000229 | Groundwater | MSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLSFCAPWEEVLV* |
| WSSedA1BaDRAFT_10140985 | 3300000309 | Wetland | ENRMSNVEQGISNDKVNSLLFFPSAFVIRYSIFCGSFLNWYAACEEVFVQDS* |
| WSSedA1Ba2DRAFT_10337232 | 3300000310 | Wetland | LAATKRKYETRMSNIEQGISNDEVKPVFPSTFDIRYSIFCGSLLNFNAACEEILV* |
| WSSedA1Ba3DRAFT_10605902 | 3300000311 | Wetland | ETRMSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLNFYAACEEVFAEGAKFLN* |
| JGI20214J14112_10235042 | 3300001279 | Wetland | MSNIEQGIPNDEVKSRLLFPSTFVIRHSILCGSLLNFYTAC |
| JGI20215J15232_10054582 | 3300001547 | Wetland | MSNFEQGMSNGEVKSFVFFPSAFDIRYSIFCRSFLNFCTPNKAVPI* |
| JGI11641J44799_1000139310 | 3300002961 | Wetland | MSNIEQGISNDEVKPILLFPSAFDIRYSTFCGSLLNFYAACVEIFV* |
| JGI11641J44799_100216882 | 3300002961 | Wetland | MSNIEQGISNDEVKPVFPSTFDIRYSIFCGSLLNFNAACEEILV* |
| JGI11641J44799_100290224 | 3300002961 | Wetland | KPENRMSNVEQGISNDKVNSLLFFPSAFVIRYSIFCGSFLNWYAACEEVFVQDS* |
| JGI11641J44799_100624651 | 3300002961 | Wetland | MSNIEQEISNHEVKSFLFFPSAFVIRYSIFCGSLFNFHAAREEVFV* |
| JGI20214J51088_100025999 | 3300003432 | Wetland | MLNVEKGISNDEVKSLLLFPSAFVIRYSIFYGSLLNFSKHH* |
| JGI20214J51088_100100985 | 3300003432 | Wetland | MSNIEQGISNDEVKPILXFPSAFDIRYSTFCGSLLNFYAACVEIFV* |
| JGI20214J51088_102395632 | 3300003432 | Wetland | MSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLNFYAACEEDFAEGAKFLN* |
| JGI20214J51650_100050481 | 3300003541 | Wetland | MSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLNFYAACEEVFAEGAKFLN* |
| Ga0031656_100057055 | 3300003858 | Freshwater Lake Sediment | MSNIEQGISNDKVKSLLFLPSAFVIRYSIFCGSFLNFYAPFEEVLF* |
| Ga0031653_100550382 | 3300003859 | Freshwater Lake Sediment | MSNIEQGISNDKVKSLLFLPSAFVIRYSIFCGSFLNFYXPFEEVLX* |
| JGI26437J51864_100005169 | 3300003910 | Freshwater Lake Sediment | MPNIEQGILNDEGKSLLLFPSVFAIHYSIFCGSLLSFXAACGEATV* |
| JGI26437J51864_100006544 | 3300003910 | Freshwater Lake Sediment | MSNIEQGIPNDEVKSLLLFPSAFVIGYSIFCGSLLNFYAACEEVFV* |
| JGI26437J51864_100028952 | 3300003910 | Freshwater Lake Sediment | MSNVEQEISNDEVKSFLLFVSEFDIRYSIFCGLLLNFYEALLAADGCEEVFG* |
| Ga0055494_100035311 | 3300004048 | Natural And Restored Wetlands | MSNVEQGISNDEVKSLLLFRSAFVIRYSIFCGSLLNFRAACGEVTG* |
| Ga0055491_100639081 | 3300004050 | Natural And Restored Wetlands | NVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLGFYPACEEVLV* |
| Ga0055514_100463971 | 3300004079 | Natural And Restored Wetlands | NVEQGIPNYEVKSLLLFPSAFDICSSIFCGSLLNFNVPCEEVLV* |
| Ga0068998_101062391 | 3300005213 | Natural And Restored Wetlands | RMSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLNFYAARAEVTSQRPPA* |
| Ga0069004_100539461 | 3300005219 | Natural And Restored Wetlands | MSNIEQGISNDGVKSLLFLPSAFVIRYSIFCGSFLNFYAACEEAF |
| Ga0074469_1009815511 | 3300005832 | Sediment (Intertidal) | MSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLGFYPACEEVLV* |
| Ga0079037_1007783292 | 3300006224 | Freshwater Wetlands | MLNVEQGISNDEVKSLLLVPSAFVIRYSTFYGSLLNFSKHY* |
| Ga0079037_1020516611 | 3300006224 | Freshwater Wetlands | KHETRMSNVEQGISNDEVKSFLLFPSAFVIRYSIFCGSFLDLHADCEEVFV* |
| Ga0079037_1023552561 | 3300006224 | Freshwater Wetlands | MPNIEQGILNDEGKSLLLFPSVFAIHYSIFCGSLLSF |
| Ga0079303_100062722 | 3300006930 | Deep Subsurface | MLNVEQGISNAEVKSLLLVPSAFVIRYSTFYGSLLNFSKHH* |
| Ga0079303_103487962 | 3300006930 | Deep Subsurface | NHETRISNIEQGISNHEVTPSLAFPSVFDIRYSIFCGSLLNFYAACVEVTD* |
| Ga0105106_104353443 | 3300009078 | Freshwater Sediment | ETRMSNVEQGISNDEVKSLLLFPSAFVIRYSTFCGSFLSFCAAFREATG* |
| Ga0105107_101881853 | 3300009087 | Freshwater Sediment | SNSNVEQGISNDEVKSLLLSPSAFDIRYSIFCGSLLSFYAACGKITR* |
| Ga0102851_100418495 | 3300009091 | Freshwater Wetlands | MSNVEQEISNGEVKSFLLFVSEFDIRYSIFCGLLLNFYEALLAADGC |
| Ga0102851_128302022 | 3300009091 | Freshwater Wetlands | SNVEQGISNDEVKSFLLFPSAFVIRYSIFCGSFLDLHADCEEVFV* |
| Ga0115026_100580461 | 3300009111 | Wetland | AEPRMLNVEQGISNAEVKSLLLVPSALVIRYSTFYGSLLNFSKHH* |
| Ga0105094_106837082 | 3300009153 | Freshwater Sediment | NSETRMSNIEQGISNDEVKPLFLFPLAFDIRYSIFCGSLLNFSASCEEVSV* |
| Ga0105094_108904282 | 3300009153 | Freshwater Sediment | SNVEQGISNDEVKPLLLFPSAFFIRYSIFYGSLLNFFANKTRA* |
| Ga0105100_102490181 | 3300009166 | Freshwater Sediment | GISNDEVKSLLLFPSAFVIRYSIFCGSLLSFYALCEEVSA* |
| Ga0113563_101608512 | 3300009167 | Freshwater Wetlands | MLNVEQGISNDEVKSLLLVPSAFVIRYSTFYGSLLNFSKHH* |
| Ga0113563_110741121 | 3300009167 | Freshwater Wetlands | RFSNIEQEISNDQVKPCLLFDSVFDIRYSIFCGWLLIFYKACRDVTG* |
| Ga0113563_112011652 | 3300009167 | Freshwater Wetlands | MSHVEQGISNDEVKSLLLFPSAFAIRYSIFSGSPLSFSAPWEEILI* |
| Ga0113563_114255512 | 3300009167 | Freshwater Wetlands | MSNIEQGISNDEVNPFLSFDLRYWIFYGSLLNFYAACEEVFG* |
| Ga0113563_137906531 | 3300009167 | Freshwater Wetlands | HETRMSNVEQGISNDEVKSFLLFPSAFVIRYSIFCGSFLDLHADCEEVFV* |
| Ga0115028_108095831 | 3300009179 | Wetland | GISNDEVKSFLLFPSAFVIRYSIFCGSFLNLHADCEEVFV* |
| Ga0123573_102254963 | 3300009509 | Mangrove Sediment | MSNVEQGISNDEVKSLLWFPSAFDIRYSIFCGSLLNFYAACEQV |
| Ga0123573_111591612 | 3300009509 | Mangrove Sediment | MSNIEQKISKDDVISLVLFPSAFIIRYSVFCCSLLNSD |
| Ga0136852_106367701 | 3300010412 | Mangrove Sediment | MSNVEQGISNDEVKSLLWFPSAFDIRYSIFCGSLLNFYAACEQVLV* |
| Ga0136851_108567012 | 3300010413 | Mangrove Sediment | MSNVEQGISNDEVKSLLLFPSVFDIRYSIFCGWLLGFYAACEEVFV* |
| Ga0136851_111767762 | 3300010413 | Mangrove Sediment | MSNVEQGISNDEDKSLVLFPSAFVIRNSIFCGSLLNFYATRKEVFT |
| (restricted) Ga0172375_100199323 | 3300013137 | Freshwater | MSNIEQGISNDEVKSSILFPSEFDIRYSIFCGLLLSF* |
| Ga0184631_101274571 | 3300018070 | Groundwater Sediment | MSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLFNFYTAREEVFV |
| Ga0184631_104180021 | 3300018070 | Groundwater Sediment | MSNVEQGISNDEVKFFLLSPSEFGIRYSIFCGSLSNFF |
| (restricted) Ga0233425_101107112 | 3300024054 | Freshwater | MSNIEQEISKDEVKPVLLFPSAFDIRYSIFCGSLLNFYAARKEIFG |
| (restricted) Ga0233425_101116433 | 3300024054 | Freshwater | MSNIEQGISNDEVKPVLFFPSAFDIRYSIFCGSLLNFYAACVEGTD |
| (restricted) Ga0233425_101220171 | 3300024054 | Freshwater | MSNIEQGISNDEVKPVLFFPSAFDIRYSIFCGSLLNFFAACVEVTD |
| Ga0210105_10022152 | 3300025966 | Natural And Restored Wetlands | MSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLGFYPACEEVLV |
| Ga0208665_101377232 | 3300027715 | Deep Subsurface | KKHQTRMSNIEQGISNDEVKSLLLFPSAFVIRYSIFCGSFLNFCALCEEVLL |
| Ga0208665_102514271 | 3300027715 | Deep Subsurface | MSNIEQKISNDEVKSLFLSPSAFDIRYSIFFSSLW |
| Ga0209373_102831511 | 3300027796 | Freshwater | MSNIEQGISNDEVKPLLLFPSAFDIRNSIFCGSLSNFS |
| Ga0209397_100275211 | 3300027871 | Wetland | MSNVEQEISNDEVKSFLLFVSEFDIRYSIFCGLLLNFYEALLAADGCEEVFG |
| Ga0209293_101642411 | 3300027877 | Wetland | MPNIEQGILNDEGKSLLLFPSVFAIHYSIFCGSLLSFFAACGE |
| Ga0209293_103820521 | 3300027877 | Wetland | LNDEGKSLLLFPSVFAIHYSIFCGSLLSFCAACGEATV |
| Ga0208980_100610332 | 3300027887 | Wetland | MSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLNFYAACEEVFAEGAKFLN |
| Ga0208980_102619952 | 3300027887 | Wetland | MSNIEQGISNDEVKPILLFPSAFDIRYSTFCGSLLNFYAACVEIFV |
| Ga0208980_104848502 | 3300027887 | Wetland | MSVEIPNVEQGISNDEVKSLLWFRSAFVIRYSAVYTPPAVSLSSFYAACEKAFA |
| Ga0209253_1000164014 | 3300027900 | Freshwater Lake Sediment | MSNIEQGISNDKVKSLLFLPSAFVIRYSIFCGSFLNFYAPFEEVLF |
| Ga0209705_100120424 | 3300027979 | Freshwater Sediment | MSNVEQGISNDEVKFFLFFPSEFIIRYSIFCGSLSNFSTSCEE |
| Ga0316602_100146791 | 3300031577 | Soil | SNIEQGISKDEVKPCLLFPSVFDIRYSIFCGSLLIFYKACRDVTG |
| Ga0315290_101686052 | 3300031834 | Sediment | MSNIEQEISNDEVKSLLFLPSAFVIRYSIFCGSFLNFYAPFEEVLF |
| Ga0315297_102155252 | 3300031873 | Sediment | MSNFEQGISNDEVKSLLLFPSAFVIRYSIFCGSLFNFYTAREEVFV |
| Ga0315292_103509222 | 3300032143 | Sediment | MSNIEQGISNDEVKSLFLFPLAFDIRYSIFCGSLSNFSASCKEVSV |
| Ga0315281_102689061 | 3300032163 | Sediment | ETRMSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSPLSVYAACRELTG |
| Ga0315281_103950051 | 3300032163 | Sediment | QTRMSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLSFCAPWEEVFV |
| Ga0315281_110472973 | 3300032163 | Sediment | VEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLNFYSTCGEITG |
| Ga0315276_107149632 | 3300032177 | Sediment | MSNVEQGISNDEVKSLLFLPSAFVIRYSIFFGSILNFFEACREITD |
| Ga0315276_116866721 | 3300032177 | Sediment | MSNIEQGISNDEVKSLLFLPSAFVIRYSIFCGSFLNFYAPFEEVLF |
| Ga0315287_102236541 | 3300032397 | Sediment | DPQTRMSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLSFCAPWEEVFV |
| Ga0315275_101086042 | 3300032401 | Sediment | MSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLSFCAPWEEVFV |
| Ga0316605_100181833 | 3300033408 | Soil | MSNIEQGIPNDEVKSLLLFPSAFVIGYSIFCGSLLNFYAACEE |
| Ga0316605_103619651 | 3300033408 | Soil | ETRMSNIEQRISNDEVKPLLLLPSAFEIRYSVFCGSHLTFYAACAETTD |
| Ga0316605_103969001 | 3300033408 | Soil | SNLIRKARMSNIEQGIPNDEVKSLLLFPSAFVIGYSIFCGSLLNFYAACEEVFV |
| Ga0316622_1006466351 | 3300033416 | Soil | MSNVEQEISNGEVKSFLLFVSEFDIRYSIFCGLLLN |
| Ga0316625_1004915231 | 3300033418 | Soil | NPETRMSNVEQGISNDEVRSSLFFPSAFGIRYSIFCGSLLSF |
| Ga0326726_108563801 | 3300033433 | Peat Soil | RETRMSNAEQRISNDEVNFFLLFPSEFIICYSIFCGSLLNIYA |
| Ga0316613_110908921 | 3300033434 | Soil | MSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLNFYAPCEEVFV |
| Ga0316600_102791912 | 3300033481 | Soil | ARGDQGISNDEVKFPRVFPSVFVIRYSTFCGSFLNFGANSE |
| Ga0316600_103210532 | 3300033481 | Soil | KSETRMSNIEQGIPNDEVKSFLSFLSDFVIRYSIFCGSILGIQASYI |
| Ga0316627_1000112326 | 3300033482 | Soil | MMTNSETRMSNIEQRISNDEVKPLLLLPSAFEIRYSIFCGSHLTFYA |
| Ga0316627_1004849042 | 3300033482 | Soil | MLNVEQGISNDEVKSLLLFPSAFVLRYSTFYGSLLNFSKHH |
| Ga0316629_101740012 | 3300033483 | Soil | MLNVEQGISNDEVKSLLLVPSAFVIRYSTFYGSLLNFSKHY |
| Ga0316626_119407932 | 3300033485 | Soil | GISNDEAKSFLSFLSDFVIRYSIFCGSILGIQASYI |
| Ga0316624_109016112 | 3300033486 | Soil | MLNVEQGISNDEVKSLLLVPSAFVIRYSTFYGSLLNFSKHH |
| Ga0316630_108485762 | 3300033487 | Soil | NANVEQGISNDEVKSFLLFPSAFVIRYSIFCGSFLNLHADCEEVFV |
| Ga0316630_121635391 | 3300033487 | Soil | NVEQGISNDEVKSLLLVPSAFVIRYSTFYGSLLNFSKHH |
| Ga0316621_102304422 | 3300033488 | Soil | MSNIEQKISNDEVKSLFLSPSAFDIRYSIFFSSLWNSFAT |
| Ga0316621_106888032 | 3300033488 | Soil | NIEQGISNNEVKALSCFPSGFIILYSTFCGSLSNFYASNTEA |
| Ga0299912_100740215 | 3300033489 | Soil | MSNIEQGISNDEVKSLLLFPSAFVIRYSIFCGSLFNFYAALEEV |
| Ga0316628_1003487172 | 3300033513 | Soil | MLNVEQGISNDEVKSLLLFPSAFVIRYSIFYGSLLNFSKHH |
| Ga0316628_1038489242 | 3300033513 | Soil | SNVEQEISNDEVKSFLLFVSEFDIRYSIFCGLLLNFYEALLAADGCEEVFG |
| Ga0316616_1024374412 | 3300033521 | Soil | MWNVEQGISNDEVKSFLLFPSAFVIRYSIFCGSFLNLHADCEE |
| Ga0316617_1006548831 | 3300033557 | Soil | MSNIEQRMSNDEVKTLCLFPSVFDIRYSIFCGSLLVFFSACAEVTTYN |
| Ga0316617_1010366581 | 3300033557 | Soil | EPRMLNVEQGISNDEGKSLLLFPSAFVLRYSTFYGSLLNFSKHH |
| Ga0316617_1014375191 | 3300033557 | Soil | MSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLNFYATREE |
| Ga0316617_1026820552 | 3300033557 | Soil | AATKLEYLNSNVEQGISNDEVKSLLLFPSAFVIRYSIFCGSLLNFYATREEVFV |
| ⦗Top⦘ |