


| Basic Information | |
|---|---|
| Family ID | F097584 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 39 residues |
| Representative Sequence | KDGRIRFAGPDRVRIERAAPTLSDRVGLVREFLGKLT |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.12 % |
| % of genes from short scaffolds (< 2000 bps) | 91.35 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.538 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (11.539 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.577 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.385 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.92% β-sheet: 0.00% Coil/Unstructured: 63.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00753 | Lactamase_B | 52.88 |
| PF13712 | Glyco_tranf_2_5 | 4.81 |
| PF00990 | GGDEF | 4.81 |
| PF01914 | MarC | 2.88 |
| PF00549 | Ligase_CoA | 1.92 |
| PF00378 | ECH_1 | 1.92 |
| PF08448 | PAS_4 | 1.92 |
| PF03401 | TctC | 0.96 |
| PF06480 | FtsH_ext | 0.96 |
| PF03461 | TRCF | 0.96 |
| PF01019 | G_glu_transpept | 0.96 |
| PF01322 | Cytochrom_C_2 | 0.96 |
| PF04264 | YceI | 0.96 |
| PF00211 | Guanylate_cyc | 0.96 |
| PF03255 | ACCA | 0.96 |
| PF00406 | ADK | 0.96 |
| PF02897 | Peptidase_S9_N | 0.96 |
| PF05649 | Peptidase_M13_N | 0.96 |
| PF10502 | Peptidase_S26 | 0.96 |
| PF03466 | LysR_substrate | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 2.88 |
| COG0045 | Succinyl-CoA synthetase, beta subunit | Energy production and conversion [C] | 1.92 |
| COG0074 | Succinyl-CoA synthetase, alpha subunit | Energy production and conversion [C] | 1.92 |
| COG1197 | Transcription-repair coupling factor (superfamily II helicase) | Transcription [K] | 1.92 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.96 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 0.96 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.96 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.96 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.96 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.96 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.96 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.96 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG3909 | Cytochrome c556 | Energy production and conversion [C] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.54 % |
| Unclassified | root | N/A | 13.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002GQ74P | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 512 | Open in IMG/M |
| 3300000312|WSSedB2BaDRAFT_1016801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 565 | Open in IMG/M |
| 3300001593|JGI12635J15846_10241474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1165 | Open in IMG/M |
| 3300004047|Ga0055499_10105732 | Not Available | 525 | Open in IMG/M |
| 3300004152|Ga0062386_101581262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300005171|Ga0066677_10201955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1113 | Open in IMG/M |
| 3300005176|Ga0066679_10029198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3018 | Open in IMG/M |
| 3300005335|Ga0070666_10864994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 667 | Open in IMG/M |
| 3300005440|Ga0070705_100684810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 803 | Open in IMG/M |
| 3300005455|Ga0070663_100151478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1779 | Open in IMG/M |
| 3300005459|Ga0068867_101567332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 615 | Open in IMG/M |
| 3300005545|Ga0070695_101275723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 606 | Open in IMG/M |
| 3300005546|Ga0070696_100012436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5709 | Open in IMG/M |
| 3300005559|Ga0066700_10851050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300005576|Ga0066708_10476067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 803 | Open in IMG/M |
| 3300005577|Ga0068857_100676599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 979 | Open in IMG/M |
| 3300005578|Ga0068854_102228261 | Not Available | 507 | Open in IMG/M |
| 3300005617|Ga0068859_100155854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2361 | Open in IMG/M |
| 3300005719|Ga0068861_100029425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4019 | Open in IMG/M |
| 3300005834|Ga0068851_10416097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 793 | Open in IMG/M |
| 3300005840|Ga0068870_10327683 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300006237|Ga0097621_100001374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 16741 | Open in IMG/M |
| 3300006854|Ga0075425_102463056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 577 | Open in IMG/M |
| 3300006871|Ga0075434_100534333 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1193 | Open in IMG/M |
| 3300006871|Ga0075434_100631936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1089 | Open in IMG/M |
| 3300006903|Ga0075426_11219407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 571 | Open in IMG/M |
| 3300007076|Ga0075435_100022088 | All Organisms → cellular organisms → Bacteria | 4906 | Open in IMG/M |
| 3300009100|Ga0075418_12437901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 571 | Open in IMG/M |
| 3300009137|Ga0066709_104565549 | Not Available | 506 | Open in IMG/M |
| 3300009148|Ga0105243_12422770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 563 | Open in IMG/M |
| 3300009792|Ga0126374_11394902 | Not Available | 570 | Open in IMG/M |
| 3300009870|Ga0131092_11398584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 538 | Open in IMG/M |
| 3300010321|Ga0134067_10316114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300010366|Ga0126379_10136645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2258 | Open in IMG/M |
| 3300010398|Ga0126383_11684382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300010398|Ga0126383_13451570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300010401|Ga0134121_11434783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 702 | Open in IMG/M |
| 3300012004|Ga0120134_1034821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 841 | Open in IMG/M |
| 3300012093|Ga0136632_10534781 | Not Available | 518 | Open in IMG/M |
| 3300012202|Ga0137363_10454250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
| 3300012285|Ga0137370_10365877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 869 | Open in IMG/M |
| 3300012354|Ga0137366_10522737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 856 | Open in IMG/M |
| 3300012357|Ga0137384_11341352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300012681|Ga0136613_10537563 | Not Available | 631 | Open in IMG/M |
| 3300012943|Ga0164241_11070862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 593 | Open in IMG/M |
| 3300013308|Ga0157375_10547071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1320 | Open in IMG/M |
| 3300014304|Ga0075340_1126431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300014325|Ga0163163_12471493 | Not Available | 578 | Open in IMG/M |
| 3300014326|Ga0157380_13418387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300014968|Ga0157379_10078831 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2950 | Open in IMG/M |
| 3300015374|Ga0132255_104474848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300019377|Ga0190264_12039772 | Not Available | 527 | Open in IMG/M |
| 3300022309|Ga0224510_10267159 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300025903|Ga0207680_10926189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 624 | Open in IMG/M |
| 3300025917|Ga0207660_10653615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 857 | Open in IMG/M |
| 3300025931|Ga0207644_11847671 | Not Available | 505 | Open in IMG/M |
| 3300025942|Ga0207689_11681065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 526 | Open in IMG/M |
| 3300025961|Ga0207712_10697052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 886 | Open in IMG/M |
| 3300025972|Ga0207668_11065781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
| 3300025985|Ga0210117_1033849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 802 | Open in IMG/M |
| 3300026035|Ga0207703_12153701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300026041|Ga0207639_11676469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 596 | Open in IMG/M |
| 3300026116|Ga0207674_10592821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1071 | Open in IMG/M |
| 3300026281|Ga0209863_10093971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 883 | Open in IMG/M |
| 3300026291|Ga0209890_10215041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 611 | Open in IMG/M |
| 3300026523|Ga0209808_1225818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 603 | Open in IMG/M |
| 3300026530|Ga0209807_1260488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300027543|Ga0209999_1028681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1032 | Open in IMG/M |
| 3300027681|Ga0208991_1129827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 749 | Open in IMG/M |
| 3300027831|Ga0209797_10465425 | Not Available | 505 | Open in IMG/M |
| 3300027890|Ga0209496_10284436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 823 | Open in IMG/M |
| 3300028379|Ga0268266_11545610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300028380|Ga0268265_12140927 | Not Available | 566 | Open in IMG/M |
| 3300028665|Ga0302160_10167177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 519 | Open in IMG/M |
| 3300029984|Ga0311332_11781531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 501 | Open in IMG/M |
| 3300029987|Ga0311334_10813141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 770 | Open in IMG/M |
| 3300029989|Ga0311365_10053166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3460 | Open in IMG/M |
| 3300030000|Ga0311337_11737657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 547 | Open in IMG/M |
| 3300030003|Ga0302172_10227172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 592 | Open in IMG/M |
| 3300030294|Ga0311349_10830925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 869 | Open in IMG/M |
| 3300030294|Ga0311349_11431959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 642 | Open in IMG/M |
| 3300030943|Ga0311366_10570043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 985 | Open in IMG/M |
| 3300030943|Ga0311366_11526028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 572 | Open in IMG/M |
| 3300031226|Ga0307497_10257926 | Not Available | 782 | Open in IMG/M |
| 3300031232|Ga0302323_101787884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 696 | Open in IMG/M |
| 3300031366|Ga0307506_10530220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300031716|Ga0310813_10384003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1204 | Open in IMG/M |
| 3300031726|Ga0302321_101494387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 778 | Open in IMG/M |
| 3300031847|Ga0310907_10189189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 975 | Open in IMG/M |
| 3300031873|Ga0315297_11632513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
| 3300031999|Ga0315274_10586657 | Not Available | 1235 | Open in IMG/M |
| 3300032003|Ga0310897_10096417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1167 | Open in IMG/M |
| 3300032066|Ga0318514_10334477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 802 | Open in IMG/M |
| 3300032074|Ga0308173_11705099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 593 | Open in IMG/M |
| 3300032090|Ga0318518_10690478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 519 | Open in IMG/M |
| 3300032122|Ga0310895_10353647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 708 | Open in IMG/M |
| 3300032205|Ga0307472_101444060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 669 | Open in IMG/M |
| 3300032275|Ga0315270_10397535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 878 | Open in IMG/M |
| 3300032954|Ga0335083_10743539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300033290|Ga0318519_10426646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 792 | Open in IMG/M |
| 3300033412|Ga0310810_10521152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1173 | Open in IMG/M |
| 3300033413|Ga0316603_10703696 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300033419|Ga0316601_101393512 | Not Available | 705 | Open in IMG/M |
| 3300034090|Ga0326723_0200105 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 11.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.85% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.85% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.92% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.96% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.96% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.96% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000312 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004047 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025985 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_11143280 | 2170459003 | Grass Soil | VQQDGRYRFAGPDRVRIERAAPTLEERVALVEAFLGRLT |
| WSSedB2BaDRAFT_10168011 | 3300000312 | Wetland | PPFDPGKLILLVQRDGRIRFAGPDRVRIERGAPALTERFALVRDFLARLA* |
| JGI12635J15846_102414743 | 3300001593 | Forest Soil | GRYRFAGPDRVRIERAAPTLEERVALVEGFLGRLT* |
| Ga0055499_101057321 | 3300004047 | Natural And Restored Wetlands | GKLILNMQRDGRTRFAGPDRVRIDRASPALADRVALVRSFLAQLA* |
| Ga0062386_1015812622 | 3300004152 | Bog Forest Soil | IQKDGRYRLAGQDRVRIERAAPSLEERVALVREFLGRLA* |
| Ga0066677_102019552 | 3300005171 | Soil | IQKDGRHRFAGQDRVRIERAAPSLEERSALVREFLGRLA* |
| Ga0066679_100291984 | 3300005176 | Soil | VQQDGRYRFAGPDRVRIERAAPTLEERVALVESFLGRLT* |
| Ga0070666_108649941 | 3300005335 | Switchgrass Rhizosphere | LEVQRDGRTRFAGPDRIRLERAAPTLDDRVALVRDFLGRL* |
| Ga0070705_1006848101 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LVQRDGRIRFAGQDRVRIERAAPALAERVGLVVDFLGRLR* |
| Ga0070663_1001514781 | 3300005455 | Corn Rhizosphere | PPFDAGKLIALIQQDGRYRFAGQDRVRIERAAPAVEDRVGLIEEFLGRLR* |
| Ga0068867_1015673321 | 3300005459 | Miscanthus Rhizosphere | VAMIRNDGRLRFAGPDRIRIDRAAPTLADRVTLVKEFVGRIG* |
| Ga0070695_1012757231 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | AIVQKDGRVRFAGPDKVRIECAAPALADRVALVRDFVGKLT* |
| Ga0070696_1000124361 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | IALIQQDGRYRFAGQDRVRIERAAPAVEDRVGLIEEFLGRLR* |
| Ga0066700_108510502 | 3300005559 | Soil | RHRFAGQNRVRIERAAPSLDQRVALVREFLGRLS* |
| Ga0066708_104760672 | 3300005576 | Soil | IQKDRRHKLAGPDKVRIEREAPTIEDRVAVVREFLGRLA* |
| Ga0068857_1006765991 | 3300005577 | Corn Rhizosphere | RIRFAGPDRIRIERAAPTLNDRVAVVRDFLGKLT* |
| Ga0068854_1022282612 | 3300005578 | Corn Rhizosphere | QRDGRTRFAGPDRVRIDRAAPTLADRVALVRSFLGQLA* |
| Ga0068859_1001558541 | 3300005617 | Switchgrass Rhizosphere | MIRNDGRLRFAGPDRIRIDRAAPTLADRVTLVKEFVGRIG* |
| Ga0068861_1000294256 | 3300005719 | Switchgrass Rhizosphere | GRVRFAGPDKVRIECAAPALADRVALVRDFAGKLT* |
| Ga0068851_104160971 | 3300005834 | Corn Rhizosphere | DGRIRFAGPDRVRIDRGAPTLAERVALVRDFLAKLA* |
| Ga0068870_103276834 | 3300005840 | Miscanthus Rhizosphere | LIRFAGPDRIRIERAAPALAERVALVREFIERLK* |
| Ga0097621_10000137418 | 3300006237 | Miscanthus Rhizosphere | DGRVRFAGPDKVRIECAAPALADRVALVRDFAGKLT* |
| Ga0075425_1024630562 | 3300006854 | Populus Rhizosphere | LVQRDGRMRFAGPDRLRIEQAAPTLDERVTLVRDFVARLK* |
| Ga0075434_1005343331 | 3300006871 | Populus Rhizosphere | RMRFAGPDRIRIEQAAPTLDERVTLVRDFLTRLK* |
| Ga0075434_1006319362 | 3300006871 | Populus Rhizosphere | IPIIRNDGRVRFAGPDRLRIDRAAPTLAERVSLVKEFIGRLN* |
| Ga0075426_112194071 | 3300006903 | Populus Rhizosphere | AGKLIALIQQDGRYRFAGQDRVRIERAAPAVEDRVGLIEEFLGRLR* |
| Ga0075435_1000220885 | 3300007076 | Populus Rhizosphere | GRHRFAGQNRVRIDRAAPTLDERVALVREFLGRLA* |
| Ga0075418_124379012 | 3300009100 | Populus Rhizosphere | GRTRFAGPDRVRLERAAPTLDERYALVRDFLNRL* |
| Ga0066709_1045655491 | 3300009137 | Grasslands Soil | KLISLVQRDGHYRFAGQDRVRIERAAPELADRVVLVEEFLGKLK* |
| Ga0105243_124227701 | 3300009148 | Miscanthus Rhizosphere | GRIRFHGQDRIRIERGAPTLADRVALVRDFLGKLQ* |
| Ga0126374_113949021 | 3300009792 | Tropical Forest Soil | RVRFAGPDRIRIDRPAPTLAERVALVKEFIGRLA* |
| Ga0131092_113985841 | 3300009870 | Activated Sludge | RTRFSGPDRVRIDRAAPMLDERIALVREFLGTLA* |
| Ga0134067_103161142 | 3300010321 | Grasslands Soil | DGRHRFAGQDRVRIERAAPTLEERSALVREFLARLA* |
| Ga0126379_101366454 | 3300010366 | Tropical Forest Soil | QKDGRHRLAGQDRVRIERAAPALEERVALVREFLSRLS* |
| Ga0126383_116843822 | 3300010398 | Tropical Forest Soil | GRMRFAGPDRIRIDRAAPTLDERVALVRDFLARLR* |
| Ga0126383_134515701 | 3300010398 | Tropical Forest Soil | KDGRYRLAGPDKVRIERAAPMLDERVTSVREFLATLS* |
| Ga0134121_114347832 | 3300010401 | Terrestrial Soil | ALMKVDGHIRFAGPNRVRIERGAPGLPDRVALIRDFLARLV* |
| Ga0120134_10348211 | 3300012004 | Permafrost | QKDGRVRFAGPDRVRIERAAATLADRIALVREFIGTLV* |
| Ga0136632_105347812 | 3300012093 | Polar Desert Sand | VQKDGRIRFAGNDKIRIERGAPMLAERVALVQDFLVGLK* |
| Ga0137363_104542502 | 3300012202 | Vadose Zone Soil | LVQRDGRYRFAGQDRVRIERAAPMLGDRVALVEEFLTKLR* |
| Ga0137370_103658771 | 3300012285 | Vadose Zone Soil | GRHRFAGQNRVRIERAAPSLDERVALVREFLGRLA* |
| Ga0137366_105227371 | 3300012354 | Vadose Zone Soil | KDGRHRFAGQDRVRIERAAPTLEERSALVREFLARLA* |
| Ga0137384_113413521 | 3300012357 | Vadose Zone Soil | RYRFAGADRVRIERAAPSLDERVALVEEFLSKVS* |
| Ga0136613_105375631 | 3300012681 | Polar Desert Sand | FDAANLITRVQKDGRIRFAGNDKIRIERGAPMLAERVALVQDFLVGLK* |
| Ga0164241_110708621 | 3300012943 | Soil | DGRIRFAGPDRIRIDHAAPGLVERIALVRDFLGKLG* |
| Ga0157375_105470712 | 3300013308 | Miscanthus Rhizosphere | RNDGRVRFAGPDRVRIDRAAPTLAERVALVKEFVAKLA* |
| Ga0075340_11264312 | 3300014304 | Natural And Restored Wetlands | LDGRIRFAGPDRIRIERAAPALADRFALVKDFIARLA* |
| Ga0163163_124714931 | 3300014325 | Switchgrass Rhizosphere | QKDVRIRFAGPDRVRIERAAPTLSERIALVRDFLASLR* |
| Ga0157380_134183871 | 3300014326 | Switchgrass Rhizosphere | EVQRDGRTRFAGPDRIRLERAAPTLDDRVALVRDFLGRL* |
| Ga0157379_100788313 | 3300014968 | Switchgrass Rhizosphere | KDGRVRFAGPDRIRIERAAPTLAERVAVIREFLEMLR* |
| Ga0132255_1044748481 | 3300015374 | Arabidopsis Rhizosphere | VQKDGRIRFAGPDRVRIDRAAPELADRVGLVREFLGRLD* |
| Ga0190264_120397721 | 3300019377 | Soil | DGRVRFAGPDRVRIERAAPALADRVTLVKEFLAKVSGSDQRPAA |
| Ga0224510_102671591 | 3300022309 | Sediment | GRTRFAGPDRVRIDRAAPALAERAALVREFFARLR |
| Ga0207680_109261892 | 3300025903 | Switchgrass Rhizosphere | NDGRLRFAGPDRIRIDRAAPTLADRVTLVKEFVGRIG |
| Ga0207660_106536152 | 3300025917 | Corn Rhizosphere | KLIALIQQDGRYRFAGQDRVRIERAAPAVEDRVGLIEEFLGKLR |
| Ga0207644_118476711 | 3300025931 | Switchgrass Rhizosphere | DGHIRFAGPDRIRIERAAPALAERVALVREFIERLK |
| Ga0207689_116810651 | 3300025942 | Miscanthus Rhizosphere | AGKLIALIQQDGRYRFAGQDRVRIERAAPAVEDRVGLIEEFLGRLR |
| Ga0207712_106970522 | 3300025961 | Switchgrass Rhizosphere | AEEFHDGRIRFAGQDRVRIERAAPALAERVGLVVEFLGRLR |
| Ga0207668_110657812 | 3300025972 | Switchgrass Rhizosphere | MAQSIEVQRDGRTRFAGPDRIRLERAAPTLDDRVALVRDFLGRL |
| Ga0210117_10338492 | 3300025985 | Natural And Restored Wetlands | REDGRVRFAGPDRVKIECAAPTLADRVALVREFAGRLA |
| Ga0207703_121537011 | 3300026035 | Switchgrass Rhizosphere | LIALIQQDGRYRFAGQDRVRIERAAPTVEDRVGLIEEFLGRLR |
| Ga0207639_116764692 | 3300026041 | Corn Rhizosphere | LLVQKDGRIRFAGPDRVRIERAAPTLADRVTLVGDFLGRLV |
| Ga0207674_105928211 | 3300026116 | Corn Rhizosphere | KDGRIRFAGPDRVRIERAAPTLSDRVGLVREFLGKLT |
| Ga0209863_100939711 | 3300026281 | Prmafrost Soil | RDGRVRFHGQDRIRIERGAPTLIDRVALVREFLGKLK |
| Ga0209890_102150412 | 3300026291 | Soil | LIALVQQDGRYRFAGPDRIRIERAAPSLEERVTLVESFLGRLA |
| Ga0209808_12258182 | 3300026523 | Soil | IQKDRRHKLAGPDKVRIEREAPTIEDRVAVVREFLGRLA |
| Ga0209807_12604881 | 3300026530 | Soil | LIVQRDGRIRFAGQDRVRIERAAPTLAERVALVEDFLGRLR |
| Ga0209999_10286812 | 3300027543 | Arabidopsis Thaliana Rhizosphere | QKDGRIRFAGPDRIRIERGAPTLNERVGLVRDFLTKLV |
| Ga0208991_11298271 | 3300027681 | Forest Soil | GRYRFAGPDRIRIERAAPTLEERVALVEAFLGRLT |
| Ga0209797_104654251 | 3300027831 | Wetland Sediment | DGRFRFAGPDRLRIEWPTRTLDDRVTLVKDFLKKLA |
| Ga0209496_102844362 | 3300027890 | Wetland | VQRDGRFRFAGPDRVRIEKAAPVLAERVALVREFLGRLA |
| Ga0268266_115456102 | 3300028379 | Switchgrass Rhizosphere | VQKDGRVRFAGPDRIRIERAAPTLAERVAVIREFLEMLR |
| Ga0268265_121409272 | 3300028380 | Switchgrass Rhizosphere | MQRDGRTRFAGPDRVRIDRAAPTLADRVALVRSFLGQLA |
| Ga0302160_101671771 | 3300028665 | Fen | GRIRFHGQDRIRIERGAPTLVDRVALVRDFLGKLK |
| Ga0311332_117815312 | 3300029984 | Fen | GRIRFHGQDRIRIERGAPTLVDRVNLVREFLGRLG |
| Ga0311334_108131412 | 3300029987 | Fen | LILLVQKDGRIRFAGQDRIRIERGAPTLGDRIALVGDFLRRLA |
| Ga0311365_100531661 | 3300029989 | Fen | LVQKDGRIRFHGQDRIRIERGAPTLVDRVALVRDFLGKLK |
| Ga0311337_117376572 | 3300030000 | Fen | LEQKDGRSRFHGQDRIRIERGAPTLVDRVALVRDFLGKLK |
| Ga0302172_102271722 | 3300030003 | Fen | DGRYRFAGQDRVRIERAAPTIDDRLVLVKEFLGKLQ |
| Ga0311349_108309252 | 3300030294 | Fen | RDGRYRFAGQDRVRIERAAPSIDDRLALVQEFLGRLA |
| Ga0311349_114319592 | 3300030294 | Fen | QKDGRIRFHGQDRIRIERGAPTLVDRVALVRDFLGKLK |
| Ga0311366_105700431 | 3300030943 | Fen | DGRYRFAGQDRVRIERAAPTIDDRLALVQEFLGKLQ |
| Ga0311366_115260282 | 3300030943 | Fen | KDGRIRFHGQDRIRIERGAPTLVDRVALVRDFLGKLK |
| Ga0307497_102579261 | 3300031226 | Soil | LIQQDGRYRFAGQDRVRIERAAPTVEDRVGLIEEFLGRLR |
| Ga0302323_1017878842 | 3300031232 | Fen | GRIRFAGPDRVRIERAAPSVAERVALVRDFLGRLQ |
| Ga0307506_105302201 | 3300031366 | Soil | RDGRVRFAGPDRLRIDRAAPTLGERVALVRGFLEKLT |
| Ga0310813_103840031 | 3300031716 | Soil | KLIALIQQDGRYRFAGQDRVRIERAAPAVEDRVGLIEEFLGRLR |
| Ga0302321_1014943871 | 3300031726 | Fen | LILLVQKDGRIRFHGQDRIRIERGAPTLVDRVNLVREFLGRLG |
| Ga0310907_101891891 | 3300031847 | Soil | RLILHMQRDGRTRFAGPDRVRIERAAPALDERVALVRGFLATLA |
| Ga0315297_116325132 | 3300031873 | Sediment | VQKDGRIRFAGPDRVRIERAAPMLADRFALVKDFIARLA |
| Ga0315274_105866572 | 3300031999 | Sediment | MQEDGRVRFAGPDRVRIERAAPTLADRFALVRDFVARLA |
| Ga0310897_100964173 | 3300032003 | Soil | QRDGRTRFAGPDRVRIERAAPALDERVALVRGFLATLA |
| Ga0318514_103344772 | 3300032066 | Soil | GTHRLAGPNRVRIERAAPSLNERAVLVREFLSQLG |
| Ga0308173_117050992 | 3300032074 | Soil | KDGRIRFAGPDRLRIESAAPALSDRVTLVRDFLAKLA |
| Ga0318518_106904781 | 3300032090 | Soil | GRYRFAGQDRVRIERAAPELADRVATVGEFLEKLR |
| Ga0310895_103536471 | 3300032122 | Soil | PARLILHMQRDGRTRFAGPDRVRIERAAPALDERVALVRGFLATLA |
| Ga0307472_1014440602 | 3300032205 | Hardwood Forest Soil | DGRIRFAGPERIRIERAAPTLQERVALLRDFLGKVR |
| Ga0315270_103975352 | 3300032275 | Sediment | QKDGRIRFHGPDRVRIERAAPALADRVALLREFLGRLA |
| Ga0335083_107435392 | 3300032954 | Soil | GRVRFAGPDRVRIDRAAPALAERVALVKEFIGKLA |
| Ga0318519_104266461 | 3300033290 | Soil | RSRRTRFAGPDRVRLERAAPTLDERVQLVRDFLSRL |
| Ga0310810_105211523 | 3300033412 | Soil | LIQQDGRYRFAGQDRVRIERAAPAVEDRVGLIEEFLGRLR |
| Ga0316603_107036961 | 3300033413 | Soil | QKDGRIRFAGPDRVRIDRAAPTLAERIMLVKDFLGRLG |
| Ga0316601_1013935122 | 3300033419 | Soil | LMVQKDGRIRFAGPDRLRIERAAPTLSDRAALIKEFLGRLG |
| Ga0326723_0200105_3_140 | 3300034090 | Peat Soil | TKLITLVQRDGRYRFAGQDRVRIERAAPDLEDRVALVEDFLGKLT |
| ⦗Top⦘ |