


| Basic Information | |
|---|---|
| Family ID | F097573 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MDSQRDDMQSLPEGIEALRALVLTTMSERDAAVTERDTLLAQN |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.41 % |
| % of genes near scaffold ends (potentially truncated) | 94.23 % |
| % of genes from short scaffolds (< 2000 bps) | 97.12 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.077 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.115 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.077 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.154 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.25% β-sheet: 0.00% Coil/Unstructured: 57.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF05717 | TnpB_IS66 | 74.04 |
| PF01527 | HTH_Tnp_1 | 21.15 |
| PF00239 | Resolvase | 0.96 |
| PF13007 | LZ_Tnp_IS66 | 0.96 |
| PF13610 | DDE_Tnp_IS240 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 74.04 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.96 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.08 % |
| Unclassified | root | N/A | 1.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000787|JGI11643J11755_10726624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300000955|JGI1027J12803_109599153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1497 | Open in IMG/M |
| 3300001173|JGI12669J13542_105253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
| 3300001661|JGI12053J15887_10503525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 578 | Open in IMG/M |
| 3300002239|JGI24034J26672_10109184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300004082|Ga0062384_101071323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
| 3300004152|Ga0062386_101667604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300005354|Ga0070675_101868787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
| 3300005435|Ga0070714_100558384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1097 | Open in IMG/M |
| 3300005459|Ga0068867_101393508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300005539|Ga0068853_100608491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 1038 | Open in IMG/M |
| 3300005578|Ga0068854_100445024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1081 | Open in IMG/M |
| 3300005616|Ga0068852_101609106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300005617|Ga0068859_100813109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 1022 | Open in IMG/M |
| 3300005617|Ga0068859_101505621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 743 | Open in IMG/M |
| 3300005952|Ga0080026_10069283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 949 | Open in IMG/M |
| 3300006052|Ga0075029_100422274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 870 | Open in IMG/M |
| 3300006057|Ga0075026_100330171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 840 | Open in IMG/M |
| 3300006059|Ga0075017_101136019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 611 | Open in IMG/M |
| 3300006358|Ga0068871_101094824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 745 | Open in IMG/M |
| 3300006893|Ga0073928_10928266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
| 3300009075|Ga0105090_10240520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1116 | Open in IMG/M |
| 3300009500|Ga0116229_11295385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 579 | Open in IMG/M |
| 3300009623|Ga0116133_1147407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 616 | Open in IMG/M |
| 3300009649|Ga0105855_1106336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 792 | Open in IMG/M |
| 3300010039|Ga0126309_10762255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
| 3300010373|Ga0134128_10827626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1026 | Open in IMG/M |
| 3300010403|Ga0134123_10492931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1151 | Open in IMG/M |
| 3300012212|Ga0150985_102061826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 869 | Open in IMG/M |
| 3300012683|Ga0137398_10567950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 783 | Open in IMG/M |
| 3300012930|Ga0137407_10728093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 935 | Open in IMG/M |
| 3300013306|Ga0163162_10644805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1183 | Open in IMG/M |
| 3300013308|Ga0157375_10678805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 1185 | Open in IMG/M |
| 3300014168|Ga0181534_10645313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
| 3300014169|Ga0181531_10675959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300014493|Ga0182016_10319933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 942 | Open in IMG/M |
| 3300014495|Ga0182015_10588083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 707 | Open in IMG/M |
| 3300016357|Ga0182032_11625896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
| 3300016445|Ga0182038_10445923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1094 | Open in IMG/M |
| 3300017946|Ga0187879_10579799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 623 | Open in IMG/M |
| 3300018033|Ga0187867_10270112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 956 | Open in IMG/M |
| 3300018088|Ga0187771_10922107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 741 | Open in IMG/M |
| 3300019786|Ga0182025_1049759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1010 | Open in IMG/M |
| 3300020579|Ga0210407_10869729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
| 3300020580|Ga0210403_11029703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 643 | Open in IMG/M |
| 3300021088|Ga0210404_10019692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2887 | Open in IMG/M |
| 3300021088|Ga0210404_10407613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 760 | Open in IMG/M |
| 3300021088|Ga0210404_10482027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
| 3300021171|Ga0210405_10415780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1058 | Open in IMG/M |
| 3300021181|Ga0210388_10517034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 1047 | Open in IMG/M |
| 3300021407|Ga0210383_10399897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1185 | Open in IMG/M |
| 3300021420|Ga0210394_10718915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 875 | Open in IMG/M |
| 3300021445|Ga0182009_10652393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 567 | Open in IMG/M |
| 3300021479|Ga0210410_11489603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300021860|Ga0213851_1371401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 974 | Open in IMG/M |
| 3300024186|Ga0247688_1040433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
| 3300025321|Ga0207656_10323652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 766 | Open in IMG/M |
| 3300025900|Ga0207710_10220453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 942 | Open in IMG/M |
| 3300025914|Ga0207671_11294834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300025934|Ga0207686_10368126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas gilardii | 1087 | Open in IMG/M |
| 3300025942|Ga0207689_10688144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 862 | Open in IMG/M |
| 3300026217|Ga0209871_1031043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1001 | Open in IMG/M |
| 3300026281|Ga0209863_10119109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 775 | Open in IMG/M |
| 3300026294|Ga0209839_10136515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 817 | Open in IMG/M |
| 3300026683|Ga0208210_100766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 560 | Open in IMG/M |
| 3300027334|Ga0209529_1087930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
| 3300027528|Ga0208985_1093695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 577 | Open in IMG/M |
| 3300027684|Ga0209626_1183670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
| 3300027692|Ga0209530_1181451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 584 | Open in IMG/M |
| 3300027737|Ga0209038_10182495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
| 3300028145|Ga0247663_1041347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 757 | Open in IMG/M |
| 3300028714|Ga0307309_10078722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 759 | Open in IMG/M |
| 3300028722|Ga0307319_10262249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300028876|Ga0307286_10366826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
| 3300028879|Ga0302229_10323667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 691 | Open in IMG/M |
| 3300029442|Ga0239579_1045593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300029944|Ga0311352_10353082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 1213 | Open in IMG/M |
| 3300030053|Ga0302177_10206186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → unclassified Roseomonas → Roseomonas sp. FDAARGOS_362 | 1081 | Open in IMG/M |
| 3300030580|Ga0311355_10521257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1136 | Open in IMG/M |
| 3300030763|Ga0265763_1045676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 539 | Open in IMG/M |
| 3300030878|Ga0265770_1143450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300031090|Ga0265760_10327836 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031234|Ga0302325_11545139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 851 | Open in IMG/M |
| 3300031543|Ga0318516_10211645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1120 | Open in IMG/M |
| 3300031573|Ga0310915_10302889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → unclassified Roseomonas → Roseomonas sp. FDAARGOS_362 | 1130 | Open in IMG/M |
| 3300031668|Ga0318542_10601187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
| 3300031680|Ga0318574_10805154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300031708|Ga0310686_105411160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 556 | Open in IMG/M |
| 3300031708|Ga0310686_108993110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 866 | Open in IMG/M |
| 3300031748|Ga0318492_10726123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300031778|Ga0318498_10277685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 753 | Open in IMG/M |
| 3300031779|Ga0318566_10191046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 1016 | Open in IMG/M |
| 3300031831|Ga0318564_10221422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas | 841 | Open in IMG/M |
| 3300031879|Ga0306919_10545111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 895 | Open in IMG/M |
| 3300031912|Ga0306921_11916635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
| 3300031938|Ga0308175_100756726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1059 | Open in IMG/M |
| 3300031943|Ga0310885_10362366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
| 3300032041|Ga0318549_10562547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 512 | Open in IMG/M |
| 3300032063|Ga0318504_10588820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300032067|Ga0318524_10672059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 546 | Open in IMG/M |
| 3300033551|Ga0247830_10413501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1051 | Open in IMG/M |
| 3300034196|Ga0370503_0099310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 988 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.77% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.88% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 2.88% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.92% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.96% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.96% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.96% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.96% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.96% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.96% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.96% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001173 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026683 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN352 (SPAdes) | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300029442 | Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM13 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034196 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J11755_107266242 | 3300000787 | Soil | MDSPRDDMQSLPEGIDALRALVLTMMSERDALALERDTL |
| JGI1027J12803_1095991532 | 3300000955 | Soil | MDSPRDDMQSLPEDIEALRALVLTTMSERDATLAERDVLALERD |
| JGI12669J13542_1052532 | 3300001173 | Forest Soil | VTDSPRDDLESLPEGIEALRALVLRTIADRDATLVERDAAVTERD |
| JGI12053J15887_105035252 | 3300001661 | Forest Soil | VTDSHPDIPQSLPDDIETLRALVLATFVERDAVVSERDTLLAQNDRLR |
| JGI24034J26672_101091842 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | MHTVPGAMQSLPESVEALRALVLATVAERDAAVIERDTLLAQN |
| Ga0062384_1010713231 | 3300004082 | Bog Forest Soil | VTDSLSDKMQTLPPDTEALRALVLATVAERDAAVTERDVLQA |
| Ga0062386_1016676042 | 3300004152 | Bog Forest Soil | MDSTPGNMQSLPEDVEALRALVLAIFVERDAAVTERDTLQAQNDRLRHLLL |
| Ga0070675_1018687871 | 3300005354 | Miscanthus Rhizosphere | MDSPRDDMQSLPEGIDALRALVLTMMSERDALALERDTLQTQNDRLRHLLLQLRR |
| Ga0070714_1005583841 | 3300005435 | Agricultural Soil | MDSPCDDMQSLPEGIDALRALVLTTMSERDALALERDTLQTQNDR |
| Ga0068867_1013935083 | 3300005459 | Miscanthus Rhizosphere | VTDSPRDDMQSLPDGIEALQALLLTMMSERDTTLAELDAAVTERDI |
| Ga0068853_1006084911 | 3300005539 | Corn Rhizosphere | MHTVPGAMQSLPESVEALRALVLATVAERDAAVIERDTLLAQNDRLRHL |
| Ga0068854_1004450244 | 3300005578 | Corn Rhizosphere | VMDSPRDDMQSLPDGIEALQALLLTMMSERDTTLAELDAAVTE |
| Ga0068852_1016091061 | 3300005616 | Corn Rhizosphere | MDSPRDDMQSLPEGIDALRALVLTMMSERDALALERDTLQTQN |
| Ga0068859_1008131093 | 3300005617 | Switchgrass Rhizosphere | VMHTVPNAMQSLPESVEALRALVLATVAERDAAVIERDTLLAQND |
| Ga0068859_1015056211 | 3300005617 | Switchgrass Rhizosphere | MDSPRDDMQSLPEGIDALRALVLTMMSERDALALERDTLQTQNDRLRHLLLQL |
| Ga0080026_100692831 | 3300005952 | Permafrost Soil | MDSPRDDLQSLPEGIEALRALVLTTMSERDVAVTERDILLAQNDR |
| Ga0075029_1004222741 | 3300006052 | Watersheds | VIDSPSENMQNLPQDAEALRALVLATLAERDAAVTERDTLL |
| Ga0075026_1003301713 | 3300006057 | Watersheds | MDSQRDDMQSLPEGIEALRALVLTTMSERDAAVTERDTLLAQNDRLRHLL |
| Ga0075017_1011360193 | 3300006059 | Watersheds | VIDSPNENLQSLPQDAEALRALVLATLAERDAAVTERDTLLAQNDRL |
| Ga0097621_1003025674 | 3300006237 | Miscanthus Rhizosphere | VTDSLQINLQSLPEDTEALRALVLATFAERDTTIAE |
| Ga0068871_1010948241 | 3300006358 | Miscanthus Rhizosphere | MDSPRDDMQSLPDGIEALQALLLTMMSERDTTLAELDAAVTERDILLAQND |
| Ga0073928_109282663 | 3300006893 | Iron-Sulfur Acid Spring | MDSPRDDMQSLPEGIEALRALVLATMSERDAAVTERDILLAQNDRLR |
| Ga0105090_102405201 | 3300009075 | Freshwater Sediment | MSDSSPDNMQSLPGTVEALRALVLAMFAERDAAVTERDTLLTQNDLLRHLPLKLTRMHF |
| Ga0116229_112953851 | 3300009500 | Host-Associated | MDSPSTDISGLPDDLAALRALVLATLVERDAAVTERDLLLAQND |
| Ga0116133_11474071 | 3300009623 | Peatland | MQSLPEDAEALRALILATFAERDAAVTERDILQAQND |
| Ga0105855_11063361 | 3300009649 | Permafrost Soil | MDSPRDDLQSLPEGIEALRALVLTTMSERDVAVTERDILLAQNDRLRHL |
| Ga0126309_107622551 | 3300010039 | Serpentine Soil | VIDSPPDNTQSLPETVKALRALVLATFAERDAAVTERDAL |
| Ga0134128_108276263 | 3300010373 | Terrestrial Soil | MDSPREDMHSLPEGLEALRALVLTTMSERDATLAERDALALERDTPQ |
| Ga0134123_104929314 | 3300010403 | Terrestrial Soil | MHTLPGAMQSLPESVEALRALVLATVAERDAAVIERD |
| Ga0150985_1020618261 | 3300012212 | Avena Fatua Rhizosphere | VTDSAPDTTQSLPESVEALRALVLATFAERDAALSERDTLLTQ |
| Ga0137398_105679501 | 3300012683 | Vadose Zone Soil | MDSRRDDMQSLPDDIEVLRALVLTTMAERDALAVERDSLYQSA* |
| Ga0137413_102967921 | 3300012924 | Vadose Zone Soil | SRVTDSLQHNVEGLPTDAEALRALVLATVAERALAS* |
| Ga0137407_107280931 | 3300012930 | Vadose Zone Soil | MDSRRDDMQSLPEGIEALRALVLTTIAERDATLVERDAAVTERDILLAQNDRL |
| Ga0163162_106448051 | 3300013306 | Switchgrass Rhizosphere | MHTVPNAMQSLPESVEALRALVLATVAERDAAVLERDTL |
| Ga0157375_106788051 | 3300013308 | Miscanthus Rhizosphere | MDSPRDDMQSLPEGIDALRALVLTMMSERDALALERDTLQTQNDRLRHL |
| Ga0181534_106453131 | 3300014168 | Bog | VTDSVPDNTQSLPETVEALRALVLATFAERDAAVTERDTLLTQNDRLRHLLL |
| Ga0181531_106759593 | 3300014169 | Bog | MQSLPEDAEALRALILATFAERDAAVTERDILQAQ |
| Ga0182016_103199333 | 3300014493 | Bog | VTDSLSDNMQSLPQDAEALRALILATFAERDAAITERDLL* |
| Ga0182015_105880833 | 3300014495 | Palsa | MQSLPEDAEALRALILATFAERDAAVTERDILQAQNDRLR |
| Ga0182032_116258961 | 3300016357 | Soil | MDSPRDDMQSLPEGTDALRALVLAMMSERDATLAERDAL |
| Ga0182038_104459231 | 3300016445 | Soil | MDSPRDDIQSLPEGIDALRALVLTMMSERDALALERDTLQTQNDRL |
| Ga0187879_105797991 | 3300017946 | Peatland | VIDSPHDMPSLPKDAEALRALVLATFVERDTAVSERDTLLAQNDRLRHLLLK |
| Ga0187867_102701123 | 3300018033 | Peatland | VTDSLQDNMQSLPEDAEALRALILATFAERDAAVTERDILQAQN |
| Ga0187771_109221071 | 3300018088 | Tropical Peatland | VTDSLQDTAPNLPDDIEALRALVLATFAERDAAVSERDILQTQNDRLRHLL |
| Ga0182025_10497591 | 3300019786 | Permafrost | MQSLPEDAEALRALILATFAERDAAINERDMPRSTSG |
| Ga0210407_108697293 | 3300020579 | Soil | MDSPRDDMQSLPEGIEALRALVLTTMSERDAAVTERDTLLAQNDRLRHLLLQLKRL |
| Ga0210403_110297031 | 3300020580 | Soil | VMDSPRTDLQSLPEGIEALRALVLTMMSERDAAVTERDVLLAQNDR |
| Ga0210404_100196921 | 3300021088 | Soil | MDSQRDDMQSLPEGIEALRALVLTTMSERDAAVTERDTLLAQN |
| Ga0210404_104076131 | 3300021088 | Soil | VTDSPRDDLESLPEGIEALRALVLRTIADRDATLVERDAAVTERDILLAQNDRRIASSRN |
| Ga0210404_104820271 | 3300021088 | Soil | MDSPRDDMQSLPEGIEALRALVLATMSERDAAVTERDTL |
| Ga0210405_104157801 | 3300021171 | Soil | MQSLPETVEALRALVLATFAERDAVVTERDTLLTQNDRLRYSY |
| Ga0210388_105170343 | 3300021181 | Soil | MQSLPETVEALRALVLATFAERDAVVTERDTLLTQNDRLRHL |
| Ga0210383_103998972 | 3300021407 | Soil | MDSQRDDMQSLPDGIEALRTLVLTTMSERDAAVTERDILLAQNDRLRHLLLQLKRV |
| Ga0210394_107189153 | 3300021420 | Soil | VMDSPRDDMQSLPEGIEALRALVLTTMSERDATLAERDVA |
| Ga0182009_106523932 | 3300021445 | Soil | MDSPRDDMQSLPEGNEALRALVLTMMSEREATLAERDALALERDILQT |
| Ga0210410_114896031 | 3300021479 | Soil | VIDSPNENLQSLPQDAEALRALVLATLAERDAAVTERDTLLAQN |
| Ga0213851_13714011 | 3300021860 | Watersheds | MDSPRDDMQSLPECIDALRALVLATMSERDALALERDTLQTQNDR |
| Ga0247688_10404331 | 3300024186 | Soil | VTDSLQENTQTLPQDAEALRALILATFAERDAAVTE |
| Ga0207656_103236521 | 3300025321 | Corn Rhizosphere | MDSPRDDMQSLPEGIDALRALVLTMMSERDALALERDTLQTQNDRLRHLLLQ |
| Ga0207710_102204533 | 3300025900 | Switchgrass Rhizosphere | MHTVPNAMQSLPESVEALRALVLATVAERDAAVIERDTLLAQNDRLR |
| Ga0207671_112948342 | 3300025914 | Corn Rhizosphere | MDSPRDDMQSLPEGIEALRALVLTTIAERDATLVERDAAVTERDILLAQNDRLR |
| Ga0207686_103681261 | 3300025934 | Miscanthus Rhizosphere | VMDSPRDDMQSLPDGIEALQALLLTMMSERDTTLAELDAAVT |
| Ga0207689_106881443 | 3300025942 | Miscanthus Rhizosphere | MDSPRDDMQSLPEGIDALRALVLTMMSERDALALE |
| Ga0209871_10310434 | 3300026217 | Permafrost Soil | VMDSPRDDMQTLPENIEALRALVLTMMSERDAAVTERYILLAHNDRLRHL |
| Ga0209863_101191093 | 3300026281 | Prmafrost Soil | VTDSPSDTMQSLPETIEALRALVLATFAERDAVVTERDTLLTQND |
| Ga0209839_101365153 | 3300026294 | Soil | VTDSLHDNMQSLPQDAEALRALILATFAERDATIAERDAAVT |
| Ga0208210_1007662 | 3300026683 | Soil | MDSPCDDMQSLPEGIDALRALVLTTMSERDALALERDTLQ |
| Ga0209529_10879302 | 3300027334 | Forest Soil | VTDSPSDTMQSLPETIEALRALVLATFAERDAAVTERDTLLTQNDRL |
| Ga0208985_10936952 | 3300027528 | Forest Soil | VTDSHPDIPQSLPDDIETLRALVLATFVERDAVVSERDTLLAQNDR |
| Ga0209626_11836701 | 3300027684 | Forest Soil | MDSQRDDMQSLPDGIEALRTLVLTTMSERDAAVTERDILLAQNDRLR |
| Ga0209530_11814512 | 3300027692 | Forest Soil | VTDSAPDNTQSLPETLEALRALALATFTDRDAVVIERDTLLTQND |
| Ga0209038_101824953 | 3300027737 | Bog Forest Soil | VTDSPRDDLESLPEGIEALRALVLRTIADRDATLVERDAAVTERDIL |
| Ga0247663_10413472 | 3300028145 | Soil | VTDSLQENTQTLPQDAEALRALILATFAERDAAVTERDILQAQNDRLRRKRSSDALV |
| Ga0307309_100787221 | 3300028714 | Soil | MDSPRDDMQSLPEGIEALRALVLTTIAERDATLVERDAAVTERDILLAQNDRL |
| Ga0307319_102622491 | 3300028722 | Soil | MDSPRDDMQSLPEGIEALRALVLTTIAERDATLVERDAAVTERDILLAQN |
| Ga0307286_103668262 | 3300028876 | Soil | MDSPRDDMQSLPDGIEALQALLLTMMSERDTTLAELDAAVTERD |
| Ga0302229_103236674 | 3300028879 | Palsa | VTDSLQDNMQSLPEDAEALRALILATFAERDAAVTERDILQ |
| Ga0239579_10455931 | 3300029442 | Freshwater Lake | MIDSPPDNKQSLPETIEALRALVLATFAERDALVSERDTLLT |
| Ga0311352_103530824 | 3300029944 | Palsa | MQSLPQDAEALRALILATFAERDAAVTERDILQAQNDRLRH |
| Ga0302177_102061861 | 3300030053 | Palsa | VTDSLQDNMQSLPEDAEALRALILATFAERDAAVTERDILQAQNDRLRHLL |
| Ga0311355_105212573 | 3300030580 | Palsa | VMDSPRTDLQSLPEGVEALRALVLTTISERDATLAERDALALERDILLAQ |
| Ga0265763_10456761 | 3300030763 | Soil | MDAPRDDLQNLPESTEALRALVLTMMSERDAAVTERDILLAQNDRLRHLL |
| Ga0265770_11434502 | 3300030878 | Soil | VIDSLPDNMQSLPETVEALRALVLATFAERDAVVTERD |
| Ga0265760_103278361 | 3300031090 | Soil | MDSPRDDMQSLPEGIEALRALVLTTMSERDAAVTERDT |
| Ga0302325_115451393 | 3300031234 | Palsa | MDSPRTDLQSLPAGIEALRALVLTTISERDATLAERDALALERDILLAQNDRLR |
| Ga0318516_102116454 | 3300031543 | Soil | MDSPRDDLQNLPADIEALRALVLTTLSERDALALERDT |
| Ga0310915_103028893 | 3300031573 | Soil | MDSRRVDTQSLPEDAAALRALVLATIAERDAAVSERDTLLAQNDRLRHL |
| Ga0318542_106011871 | 3300031668 | Soil | MDSPRDDIQSLPEGIDALRALVLTMMSERDALALERDTLQT |
| Ga0318574_108051542 | 3300031680 | Soil | MDSPRDDLQNLPADIEALRALVLTTLSERDALALERD |
| Ga0310686_1054111602 | 3300031708 | Soil | VTDSLSDKMQSLPQDVEALRALILATFAERDAAVTERDVLQAQND |
| Ga0310686_1089931103 | 3300031708 | Soil | VTDSLSDTMQSLPETIEALRALVLATFAERDAAVTERDTLLTQNDRLRHLL |
| Ga0318492_107261231 | 3300031748 | Soil | MDSPRDDLQSLPEGIDALQALVLTTMSERDALALERDTLQTQNDRLRHLLLQLR |
| Ga0318498_102776853 | 3300031778 | Soil | MDSPRDDLQNLPADIEALRALVLTTLSERDALALERDTLQTQNDRLRHLLLQL |
| Ga0318566_101910461 | 3300031779 | Soil | MDSPRDDIQSLPEGIDALRALVLTMMSERDALALERDTLQTQNDRLRHLLLQLRR |
| Ga0318564_102214221 | 3300031831 | Soil | MDSPRDDIQSLPEGIDALRALVLTMMSERDALALERDTLQTQNDRLRHLL |
| Ga0306919_105451111 | 3300031879 | Soil | MDSPRDDIQSLPEGIDALRALVLTMMSERDALALERDTLQTQN |
| Ga0306921_119166351 | 3300031912 | Soil | MDSRRDDMQSLPEGIDALRALVLATMSERDALALERDTLQTQNDRLRHLLLQLR |
| Ga0308175_1007567261 | 3300031938 | Soil | MDSPREDMQSLPESIEALRALVLTTMSERDATLAERDALALERDTLQT |
| Ga0310885_103623661 | 3300031943 | Soil | MHTVPDAMQSLPESVEALRALVLATVAERDAAVIERNTLLAQND |
| Ga0318549_105625472 | 3300032041 | Soil | MDSPRDDIQSLPEGIDALRALVLTMMSERDALALERDTLQTQNDRLRHL |
| Ga0318504_105888202 | 3300032063 | Soil | MDSPRDDIQSLPEGIDALRALVLTMMSERDALALERDT |
| Ga0318524_106720591 | 3300032067 | Soil | MDSPRDDLRSLPEGIDALRALVLTTMSERDALALERD |
| Ga0247830_104135011 | 3300033551 | Soil | MDSPRDDMQSLPEGIDALRALVLTMMSERDALALERDTLQT |
| Ga0370503_0099310_2_109 | 3300034196 | Untreated Peat Soil | MTDSPPDNTQSLPETVQALRALVLATLAERDAPVTE |
| ⦗Top⦘ |