


| Basic Information | |
|---|---|
| Family ID | F097556 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MWKLKLIGLLMTIVYWVFSLILVYSVMMSIFRYAFGVQLPNPFSIFQAR |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 89.42 % |
| % of genes near scaffold ends (potentially truncated) | 29.81 % |
| % of genes from short scaffolds (< 2000 bps) | 85.58 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.923 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.385 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.769 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.35% β-sheet: 0.00% Coil/Unstructured: 50.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 6.73 |
| PF01494 | FAD_binding_3 | 2.88 |
| PF00872 | Transposase_mut | 2.88 |
| PF00296 | Bac_luciferase | 1.92 |
| PF03401 | TctC | 0.96 |
| PF00106 | adh_short | 0.96 |
| PF07729 | FCD | 0.96 |
| PF01557 | FAA_hydrolase | 0.96 |
| PF00534 | Glycos_transf_1 | 0.96 |
| PF01734 | Patatin | 0.96 |
| PF00078 | RVT_1 | 0.96 |
| PF13474 | SnoaL_3 | 0.96 |
| PF01042 | Ribonuc_L-PSP | 0.96 |
| PF00892 | EamA | 0.96 |
| PF12770 | CHAT | 0.96 |
| PF08887 | GAD-like | 0.96 |
| PF04290 | DctQ | 0.96 |
| PF09361 | Phasin_2 | 0.96 |
| PF00144 | Beta-lactamase | 0.96 |
| PF16499 | Melibiase_2 | 0.96 |
| PF01381 | HTH_3 | 0.96 |
| PF14023 | DUF4239 | 0.96 |
| PF02517 | Rce1-like | 0.96 |
| PF13683 | rve_3 | 0.96 |
| PF07883 | Cupin_2 | 0.96 |
| PF03411 | Peptidase_M74 | 0.96 |
| PF06863 | DUF1254 | 0.96 |
| PF00884 | Sulfatase | 0.96 |
| PF01527 | HTH_Tnp_1 | 0.96 |
| PF01425 | Amidase | 0.96 |
| PF13924 | Lipocalin_5 | 0.96 |
| PF00515 | TPR_1 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 6.73 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 5.77 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 2.88 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 2.88 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 2.88 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 2.88 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.92 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.96 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.96 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.96 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.96 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.96 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.96 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.96 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.96 |
| COG3770 | Murein endopeptidase MepA (D-alanyl-D-alanine-endopeptidase) | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.96 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.96 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.96 |
| COG5620 | Uncharacterized conserved protein, DUF1851 domain | Function unknown [S] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.92 % |
| Unclassified | root | N/A | 48.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459011|GKWS7RC01DYC2H | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium aeschynomenes | 500 | Open in IMG/M |
| 3300001661|JGI12053J15887_10422993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
| 3300004114|Ga0062593_101335029 | Not Available | 762 | Open in IMG/M |
| 3300004156|Ga0062589_101680927 | Not Available | 632 | Open in IMG/M |
| 3300004479|Ga0062595_101260635 | Not Available | 662 | Open in IMG/M |
| 3300005093|Ga0062594_102048482 | Not Available | 613 | Open in IMG/M |
| 3300005164|Ga0066815_10091133 | Not Available | 562 | Open in IMG/M |
| 3300005356|Ga0070674_101258435 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005564|Ga0070664_100141643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2118 | Open in IMG/M |
| 3300005713|Ga0066905_101775819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. YR768 | 568 | Open in IMG/M |
| 3300005719|Ga0068861_100578687 | Not Available | 1027 | Open in IMG/M |
| 3300006046|Ga0066652_101706865 | Not Available | 574 | Open in IMG/M |
| 3300006237|Ga0097621_100905261 | Not Available | 822 | Open in IMG/M |
| 3300006844|Ga0075428_100098596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Chitinimonas → Chitinimonas koreensis | 3186 | Open in IMG/M |
| 3300006844|Ga0075428_100339402 | All Organisms → cellular organisms → Bacteria | 1613 | Open in IMG/M |
| 3300006844|Ga0075428_100811821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 994 | Open in IMG/M |
| 3300006845|Ga0075421_101659390 | Not Available | 693 | Open in IMG/M |
| 3300006847|Ga0075431_100107804 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2874 | Open in IMG/M |
| 3300006847|Ga0075431_101893302 | Not Available | 552 | Open in IMG/M |
| 3300006853|Ga0075420_100655197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Chitinimonas → Chitinimonas koreensis | 906 | Open in IMG/M |
| 3300006871|Ga0075434_100563426 | Not Available | 1159 | Open in IMG/M |
| 3300006954|Ga0079219_11432671 | Not Available | 620 | Open in IMG/M |
| 3300007258|Ga0099793_10267017 | Not Available | 828 | Open in IMG/M |
| 3300009093|Ga0105240_10225589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2180 | Open in IMG/M |
| 3300009094|Ga0111539_10411213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1576 | Open in IMG/M |
| 3300009098|Ga0105245_12766636 | Not Available | 543 | Open in IMG/M |
| 3300009100|Ga0075418_10476612 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300009143|Ga0099792_11129368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300009148|Ga0105243_11733547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter subgen. Acetobacter → Acetobacter aceti | 654 | Open in IMG/M |
| 3300009148|Ga0105243_13011374 | Not Available | 511 | Open in IMG/M |
| 3300009792|Ga0126374_10123947 | Not Available | 1517 | Open in IMG/M |
| 3300010043|Ga0126380_10017963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3336 | Open in IMG/M |
| 3300010360|Ga0126372_13093259 | Not Available | 516 | Open in IMG/M |
| 3300010401|Ga0134121_11410502 | Not Available | 707 | Open in IMG/M |
| 3300012198|Ga0137364_11208705 | Not Available | 566 | Open in IMG/M |
| 3300012199|Ga0137383_10732196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. MOS002 | 722 | Open in IMG/M |
| 3300012208|Ga0137376_11625864 | Not Available | 537 | Open in IMG/M |
| 3300012361|Ga0137360_10019000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4547 | Open in IMG/M |
| 3300012510|Ga0157316_1082163 | Not Available | 506 | Open in IMG/M |
| 3300012683|Ga0137398_10293431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1092 | Open in IMG/M |
| 3300012929|Ga0137404_10379657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella silvestris | 1243 | Open in IMG/M |
| 3300012951|Ga0164300_10862832 | Not Available | 568 | Open in IMG/M |
| 3300012987|Ga0164307_10802002 | Not Available | 748 | Open in IMG/M |
| 3300012989|Ga0164305_12127522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 515 | Open in IMG/M |
| 3300013306|Ga0163162_10518886 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300014325|Ga0163163_10800790 | Not Available | 1006 | Open in IMG/M |
| 3300014968|Ga0157379_10370705 | Not Available | 1313 | Open in IMG/M |
| 3300015371|Ga0132258_10004787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 26351 | Open in IMG/M |
| 3300015371|Ga0132258_10206405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4769 | Open in IMG/M |
| 3300015371|Ga0132258_10271190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4159 | Open in IMG/M |
| 3300015371|Ga0132258_10288599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4030 | Open in IMG/M |
| 3300015371|Ga0132258_10641071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2671 | Open in IMG/M |
| 3300015371|Ga0132258_12395607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga arsenatis | 1322 | Open in IMG/M |
| 3300015372|Ga0132256_101310488 | Not Available | 837 | Open in IMG/M |
| 3300015374|Ga0132255_104166581 | Not Available | 613 | Open in IMG/M |
| 3300016371|Ga0182034_11474889 | Not Available | 596 | Open in IMG/M |
| 3300016387|Ga0182040_11586694 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300016404|Ga0182037_11539123 | Not Available | 590 | Open in IMG/M |
| 3300016422|Ga0182039_10775483 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300016422|Ga0182039_10959338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 765 | Open in IMG/M |
| 3300017792|Ga0163161_10689788 | Not Available | 849 | Open in IMG/M |
| 3300017947|Ga0187785_10118526 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300017947|Ga0187785_10118835 | Not Available | 1078 | Open in IMG/M |
| 3300017974|Ga0187777_10099402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1910 | Open in IMG/M |
| 3300018081|Ga0184625_10190183 | Not Available | 1076 | Open in IMG/M |
| 3300019883|Ga0193725_1098171 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 695 | Open in IMG/M |
| 3300019885|Ga0193747_1054650 | Not Available | 990 | Open in IMG/M |
| 3300019886|Ga0193727_1020999 | Not Available | 2340 | Open in IMG/M |
| 3300021082|Ga0210380_10017477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3027 | Open in IMG/M |
| 3300025900|Ga0207710_10126963 | Not Available | 1222 | Open in IMG/M |
| 3300025900|Ga0207710_10264985 | Not Available | 862 | Open in IMG/M |
| 3300025913|Ga0207695_10318610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1445 | Open in IMG/M |
| 3300025927|Ga0207687_11335083 | Not Available | 616 | Open in IMG/M |
| 3300025939|Ga0207665_11092472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 636 | Open in IMG/M |
| 3300025972|Ga0207668_10632989 | Not Available | 935 | Open in IMG/M |
| 3300026035|Ga0207703_10129186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 2180 | Open in IMG/M |
| 3300026121|Ga0207683_10350205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1355 | Open in IMG/M |
| 3300027880|Ga0209481_10064472 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300027909|Ga0209382_10346178 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300027909|Ga0209382_10763657 | Not Available | 1033 | Open in IMG/M |
| 3300027909|Ga0209382_11736863 | Not Available | 611 | Open in IMG/M |
| 3300027915|Ga0209069_10338137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 809 | Open in IMG/M |
| 3300028379|Ga0268266_11391789 | Not Available | 677 | Open in IMG/M |
| 3300031152|Ga0307501_10255071 | Not Available | 524 | Open in IMG/M |
| 3300031446|Ga0170820_16296726 | Not Available | 807 | Open in IMG/M |
| 3300031474|Ga0170818_100232024 | Not Available | 959 | Open in IMG/M |
| 3300031545|Ga0318541_10489749 | Not Available | 688 | Open in IMG/M |
| 3300031546|Ga0318538_10189926 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300031719|Ga0306917_11024993 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300031777|Ga0318543_10296458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300031799|Ga0318565_10596785 | Not Available | 531 | Open in IMG/M |
| 3300031879|Ga0306919_10256018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1318 | Open in IMG/M |
| 3300031890|Ga0306925_10303791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1716 | Open in IMG/M |
| 3300031890|Ga0306925_12041123 | Not Available | 539 | Open in IMG/M |
| 3300031912|Ga0306921_10062717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 4244 | Open in IMG/M |
| 3300031912|Ga0306921_10913991 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300031940|Ga0310901_10578650 | Not Available | 512 | Open in IMG/M |
| 3300031954|Ga0306926_11047452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 968 | Open in IMG/M |
| 3300031954|Ga0306926_11901911 | Not Available | 672 | Open in IMG/M |
| 3300032001|Ga0306922_10307368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1703 | Open in IMG/M |
| 3300032076|Ga0306924_11935061 | Not Available | 610 | Open in IMG/M |
| 3300032076|Ga0306924_11940105 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300032180|Ga0307471_102451499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 660 | Open in IMG/M |
| 3300034090|Ga0326723_0558439 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.46% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.73% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459011 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cm | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F64_06224130 | 2170459011 | Grass Soil | MWKLKLIGLLMTIVYWVFSLVLVYGVMMSIFRYAFGVHLPNPFSIFQA |
| JGI12053J15887_104229931 | 3300001661 | Forest Soil | MWKLKLIGLLMTIVYWVFSLILVYSVMMSIFRYAFGVQLPNPFSIFQGR* |
| Ga0062593_1013350291 | 3300004114 | Soil | MWKLKLIGSLVTILFWVYSLILVYSVTMSIFRYAFGVQLPNPFSIF |
| Ga0062589_1016809272 | 3300004156 | Soil | MWKLKFIGILMTTVFWAYSLILVYSVTMSIFRYAFGVQLPNPFAIFQAR* |
| Ga0062595_1012606352 | 3300004479 | Soil | MWKLKLIGLLMTTVYWVFSLTLIYSVMMSIFRYAFGVQLP |
| Ga0062594_1020484821 | 3300005093 | Soil | LIGLLMTTIFWAYSLILIYSVMMSVIRYAFGVQLPNPFSIFQAR* |
| Ga0066815_100911331 | 3300005164 | Soil | MWKLKLIGLLMTTVYWVFSLVLIYSVMMSIFRYAFGVQLPNPFSIFQAR* |
| Ga0070674_1012584351 | 3300005356 | Miscanthus Rhizosphere | MWKLKLIGLLVTIVYWVFSLVLIYSVLMSIFRYAFGVQLPNPFSIFQGP* |
| Ga0070664_1001416435 | 3300005564 | Corn Rhizosphere | MWKLKFIGILMTTVFWAYSLILVYSVTMSIFRYAFGVQLPNPFAIFQ |
| Ga0066905_1017758192 | 3300005713 | Tropical Forest Soil | MWKLRLFGLLVMIIFWVYSFILVYSVTMSIFRYTFGVQLPNPFSIFKRDEHINKDR* |
| Ga0068861_1005786872 | 3300005719 | Switchgrass Rhizosphere | MWKLKLIGLLMTTIFWAYSLILIYSVMMSVIRYAFGVQLPNPFSIFQAR* |
| Ga0066652_1017068652 | 3300006046 | Soil | MWKLKLIGLLMTIAYWVFSLILVYGVMMSIFRYAF |
| Ga0097621_1009052612 | 3300006237 | Miscanthus Rhizosphere | MWKLKLMGLLVTIIYWVFSLVLIYSVLMSIFRYAFGVQLPNPFSIFQGP* |
| Ga0075428_1000985963 | 3300006844 | Populus Rhizosphere | MWKVKLMGILIATVFWVYSLILVYSVTMSIFRYAFGVQLPNPFSIFQAR* |
| Ga0075428_1003394022 | 3300006844 | Populus Rhizosphere | MWKVKLMGLLIATVFWVYSLILIYSVTMSILRYAFGVQLPNPFSIFQAR* |
| Ga0075428_1008118213 | 3300006844 | Populus Rhizosphere | MWKLKLIGLFIIIVYSMFSLTLVYGVMMSIFRYAFGVQLPNPFSIFQGP* |
| Ga0075421_1016593902 | 3300006845 | Populus Rhizosphere | MWKLKLIGLLITMVFWVYSLILVYSVTMSIFLYAFGVQLPNPFSIFQAR* |
| Ga0075431_1001078045 | 3300006847 | Populus Rhizosphere | MWKLKLIGLLITMVFSLILVYSVTMSIFLYAFGVQLPNPFSIFQAR* |
| Ga0075431_1018933022 | 3300006847 | Populus Rhizosphere | MWKLKLIGLFIIVVYSMFSLTLVYGVMMSIFRYAFGVQLPNPFSIFQGP* |
| Ga0075420_1006551971 | 3300006853 | Populus Rhizosphere | MWKVKLMGILIATVFWVYSLILVYSVTMSIFRYAFGVQLPNPFSIFQ |
| Ga0075434_1005634262 | 3300006871 | Populus Rhizosphere | MWKFKLIGLLMTIVFWVYSLILVYSVTISIFRYAFGVQLPNPFSIFQAR* |
| Ga0079219_114326712 | 3300006954 | Agricultural Soil | WKLKLIGLLMTTIFWAYSLILIYSVMMSVIRYAFGVQLPSPFSIFQAR* |
| Ga0099793_102670172 | 3300007258 | Vadose Zone Soil | MWKLKLIGLLMTIVYWVFSLILIYSVMMSIFRYAFGVQLPNPFSIFQGP* |
| Ga0105240_102255894 | 3300009093 | Corn Rhizosphere | MWKLKLIGLLMTTVYWVFSLTLIYSVMMSIFRYAFGVQLPNPFSILQGP* |
| Ga0111539_104112132 | 3300009094 | Populus Rhizosphere | MWKLKLIGLLITTVFWVYSLILVYSVTMSIFSYAFGVQLPNPFSIFQAR* |
| Ga0105245_127666361 | 3300009098 | Miscanthus Rhizosphere | MWKLKLIGLLMSVVYWAFSLILIYSVMMSIFRYAFGVQLPNPFSIFQGP* |
| Ga0075418_104766122 | 3300009100 | Populus Rhizosphere | MWKVKLMGLLIATVFWVYSLILVYSVIMSIFRYAFDVQLPNPFSIFQAR* |
| Ga0099792_111293681 | 3300009143 | Vadose Zone Soil | VEVKMWKLKFIGLLMTVVYWAFSLTLIYSVMMSIFRYAFGIQLPNPFSIFQGP* |
| Ga0105243_117335472 | 3300009148 | Miscanthus Rhizosphere | MWKLKLIGLLMTMVYWAFSLILIYSVMMSIFRYAFGVQLP |
| Ga0105243_130113741 | 3300009148 | Miscanthus Rhizosphere | MWKLKLIGLLVTIVYWVFSLVMIYSVMMSIFRYAFGVQLPNPFSIFQG |
| Ga0126374_101239472 | 3300009792 | Tropical Forest Soil | MWKLKLIGLLMTIVYWAFSLILVYGVTMSIFRYAFGVQLPNPFAIFQGR* |
| Ga0126380_100179636 | 3300010043 | Tropical Forest Soil | MWKLKLIGQLMTIIFWAYSLILVYSVMMSIFRYTFGVQLPNPFAIFQAR* |
| Ga0126372_130932591 | 3300010360 | Tropical Forest Soil | MWKFKLSGLLMTIVFWVYSLILVYSVAMSIFRYAFGVQLPNPFS |
| Ga0134121_114105021 | 3300010401 | Terrestrial Soil | MWKLKLIGLLMTIVYWVFSLVLIYSVMMSIFRYAFAVQLPNPFSIFQGP* |
| Ga0137364_112087051 | 3300012198 | Vadose Zone Soil | MWKLKLIGLLMTIVYWVFSLILVYSVMMSIFRYAFGVQLPNPFSIFQGP* |
| Ga0137383_107321962 | 3300012199 | Vadose Zone Soil | MWKLKLIGLLMTIVYWAFSLILVYSVMMSIFRYAFGVQLPNPFSIFQGP* |
| Ga0137376_116258641 | 3300012208 | Vadose Zone Soil | MWKLKLIGLLMTIVYWVFSLILIYGVMMSIFRYAFGI |
| Ga0137360_100190004 | 3300012361 | Vadose Zone Soil | MWKLKLIGLLMTIVYWVFSLILVYSVMMSVFRYAFGVQLPNPFSIFQGR* |
| Ga0157316_10821631 | 3300012510 | Arabidopsis Rhizosphere | MWKLKLIGLFITIVFWLYSLILVYSVTMSIFRYAFGVQLPNPFAIFQAR* |
| Ga0137398_102934311 | 3300012683 | Vadose Zone Soil | MWKLKLIGLLITIVYWMFSLILIYSVMMSIFRYAFGVQLPNPFS |
| Ga0137404_103796573 | 3300012929 | Vadose Zone Soil | MWKLKLIGLLMTTVYSVFSFILVYSVMMSIFRYAFDVQLPNPFSIFQGR* |
| Ga0164300_108628321 | 3300012951 | Soil | MWKLKLIGLLVTIVYWAFSLVLIYSVMMSIFRYAFGVQLPNPFLIFQGP* |
| Ga0164307_108020022 | 3300012987 | Soil | MWKLKLIGLLVTIVYWVFSLVLIYSVMMSIFRYAFGVQLPNPFLIFLGP* |
| Ga0164305_121275221 | 3300012989 | Soil | MWKLKLIGLLMTTVYWVFSLVLIYSVMMSIFRYAFG |
| Ga0163162_105188862 | 3300013306 | Switchgrass Rhizosphere | GLLMTTVYWVFSLVLIYSVMMSIFRYAFGVQLPNPFLIFQGP* |
| Ga0163163_108007901 | 3300014325 | Switchgrass Rhizosphere | MWKLKLIGLLVTIVYWVFSLVLIYSVMMSIFRYAFG |
| Ga0157379_103707051 | 3300014968 | Switchgrass Rhizosphere | MWKLKLIGLLVTIVYWVFSLVLIYSVLMSIFRYAFGVQLPNPFSIFHVR* |
| Ga0132258_1000478722 | 3300015371 | Arabidopsis Rhizosphere | MWKLKFIGLLMTTVFWAYSLILVYSVTMSIFRYAFGVQLPNPFAIFQAR* |
| Ga0132258_102064052 | 3300015371 | Arabidopsis Rhizosphere | MWKFKLIGLLMTIVLWVYSLILVYSVTVSIFRYAFGVQLPNQFSIFQAR* |
| Ga0132258_102711904 | 3300015371 | Arabidopsis Rhizosphere | MWKLKLIGLLMTIVYWMFSLILVYSAMMSIFRYAFGVHLPNPFSIFQAR* |
| Ga0132258_102885994 | 3300015371 | Arabidopsis Rhizosphere | MWKFKLIGLLMTIVFWIYSLILVYSVTISIFRYAFGVQLPNPFSIFQAR* |
| Ga0132258_106410712 | 3300015371 | Arabidopsis Rhizosphere | MWKLKLMALLITIVYWAFSLILVYSVMMSIFRYAFGVHLPNPFSIFQAR* |
| Ga0132258_123956073 | 3300015371 | Arabidopsis Rhizosphere | MWKLKLIGQLMTVIFCAYSLILIYSVMMSIFRYTFGVQLPNPFAIFQAR* |
| Ga0132256_1013104881 | 3300015372 | Arabidopsis Rhizosphere | MWKFKLIGLLMTIVFWVYSLILVYSVTISIFRYAFGVQLPNP |
| Ga0132255_1041665812 | 3300015374 | Arabidopsis Rhizosphere | MWKLKLIGLLMTIVYWVFSLILVYGVMMSIFRYAFGVHLPNPFSIFQAR* |
| Ga0182034_114748891 | 3300016371 | Soil | MWKLKLIGKLMTIVFWVYSLILVYSVMMSIFRYAFG |
| Ga0182040_115866941 | 3300016387 | Soil | RMWKLKLIGLLMTIVYWAFSLILVYSVTMSIFRYAFGVQLPNPFAIFQGR |
| Ga0182037_115391233 | 3300016404 | Soil | DLMKWERRMWKLKLIGLLMTIVYWAFSLILVYSVMMSIFRYAFGVQLPNPFAIFQGR |
| Ga0182039_107754832 | 3300016422 | Soil | MWKLKLIGLSMTIVYWAFSLILVYSVMMSIFRYAFGVQLPNPFSIFQAR |
| Ga0182039_109593381 | 3300016422 | Soil | MWKLKLIGKLMTIVFWVYSLILVYSVMMSIFRYAFGVQLPNPF |
| Ga0163161_106897882 | 3300017792 | Switchgrass Rhizosphere | MWKLKLIGLLVTIVYWAFSLVLIYSVLMSIFRYAFGVQLPNPFSIFQGP |
| Ga0187785_101185262 | 3300017947 | Tropical Peatland | MRKLKLFGLLITMLFWVYSLILIYSVMMTVLRYAFGVQLPNPFSIFQAR |
| Ga0187785_101188352 | 3300017947 | Tropical Peatland | MWKLELIGRLMTIVFFVYSLFLVYSVMMSIFRYAFGVELPNPFLIF |
| Ga0187777_100994023 | 3300017974 | Tropical Peatland | MWKLRLIGLLMTIVYWAFSLILVYSVMMSIFRYAFGFQLPNPFAIFQGR |
| Ga0184625_101901832 | 3300018081 | Groundwater Sediment | PDLMKWERRMWKLKLIGLLVMIVYGTFSLILVYSVMMSIFRYAFGVQLPNPFSIFQGR |
| Ga0193725_10981712 | 3300019883 | Soil | MWKLKLIGLLMTIVYWVFSLILIYSVMMSIFRYAFGVQLPNPFSIFQGP |
| Ga0193747_10546502 | 3300019885 | Soil | MWKLKLIGLLMTIVYWVFSLILVYSVMMSIFRYAFGVHLPNPFSIFQAR |
| Ga0193727_10209993 | 3300019886 | Soil | MWKLKLIGLLMTIVYWVFSLILVYSVMMSIFRYAFGVQLPNPFSIFQGR |
| Ga0210380_100174771 | 3300021082 | Groundwater Sediment | MWKLKLIGLLVTILFWVYSLILVYSVTMSIFRYAFGVQLPNPFSIFHVR |
| Ga0207710_101269632 | 3300025900 | Switchgrass Rhizosphere | MWKLKLIGLLMTTIFWAYSLILIYSVMMSVIRYAFGVQLPNPFSIFQAR |
| Ga0207710_102649852 | 3300025900 | Switchgrass Rhizosphere | MWKLKFIGILMTTVFWAYSLILVYSVTMSIFRYAFGVQLPNPFAIFQAR |
| Ga0207695_103186103 | 3300025913 | Corn Rhizosphere | MWKLKLIGLLMTTVYWVFSLTLIYSVMMSIFRYAFGVQLPNPFSILQGP |
| Ga0207687_113350832 | 3300025927 | Miscanthus Rhizosphere | MWKLKLIGLLMTIVYWVFSLILIYSVMMSVIRYAFGVQLPNPFSIFQAR |
| Ga0207665_110924722 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MWKLKLIGLIMTTVYWVFSLTLIYSVMMSIFRYAFGVQLPNPFS |
| Ga0207668_106329892 | 3300025972 | Switchgrass Rhizosphere | MWKLKLIGLLVTILFWVYSLILVYSVMISIFRYAFGVQLPNPFSIFQAR |
| Ga0207703_101291861 | 3300026035 | Switchgrass Rhizosphere | MWKLKFIGILMTTVFWAYSLILVYSVTMSIFRYAFGVQLPNPFA |
| Ga0207683_103502052 | 3300026121 | Miscanthus Rhizosphere | MWKLKLIGLLVTIVYWVFSLVLIYSVMMSIFRYAFAVQLPNPFSIFQGP |
| Ga0209481_100644721 | 3300027880 | Populus Rhizosphere | MWKVKLMGLLIATVFWVYSLILIYSVTMSILRYAFGVQLPNPFSIFQAR |
| Ga0209382_103461783 | 3300027909 | Populus Rhizosphere | MWKLKLIGLFIIIVYSMFSLTLVYGVMMSIFRYAFGVQLPNPFSIFQGP |
| Ga0209382_107636572 | 3300027909 | Populus Rhizosphere | MWKVKLMGILIATVFWVYSLILVYSVTMSIFRYAFGVQLPNPFSIFQAR |
| Ga0209382_117368631 | 3300027909 | Populus Rhizosphere | MWKLKLIGLLITMVFWVYSLILVYSVTMSIFLYAFGVQLPNPFSIFQAR |
| Ga0209069_103381372 | 3300027915 | Watersheds | MWKLKLNGLLMTIVYWVFSLILVYGGMMSIFRYAFGVQLPNPFSIFQGP |
| Ga0268266_113917891 | 3300028379 | Switchgrass Rhizosphere | MWKLKFIGILMTTVFWAYSLILVYSVTMSIFRYAFGVQLPNPF |
| Ga0307501_102550711 | 3300031152 | Soil | MWKLKLIGLLMTIVYWVFSLILIYGVMMSIFRYAFGIQLPNP |
| Ga0170820_162967261 | 3300031446 | Forest Soil | MWKLKLIGLLMTIVYWVFSLVLIYSVMMSIFRYAFGVQLPNPFSIFQGP |
| Ga0170818_1002320242 | 3300031474 | Forest Soil | MWKLKLIGLLMTIVYWVFSLVLIYSVMMSLFRYAFGVQLPNPFSIFQGP |
| Ga0318541_104897492 | 3300031545 | Soil | MWKLKLIGLLMAIVYWVFSLILVYSVMMSIFRYAFGVQLPNPFSIFQAR |
| Ga0318538_101899262 | 3300031546 | Soil | MWKLKLIGLLMTIVYWVFSLILVYSVMMSIFRYAFGVQLPNPFSIFQAR |
| Ga0306917_110249931 | 3300031719 | Soil | KLKLIGLLMTIVYWAFSLILVYSVTMSIFRYAFGVQLPNPFAIFQGR |
| Ga0318543_102964582 | 3300031777 | Soil | MWKLKLIGLLMTIVYWAFSLILVYSVMMSIFRYAFGVQLPNPFAIFQGR |
| Ga0318565_105967852 | 3300031799 | Soil | MWKLKLIGLLMTIVYWVFSLILVYSVMMSIFRYAFGVQL |
| Ga0306919_102560181 | 3300031879 | Soil | LKLIGLLMAIVYWVFSLILVYSVMMSIFRYAFGVQLPNPFSIFQAR |
| Ga0306925_103037912 | 3300031890 | Soil | MWKLKLVGQLMTMVFWMYSLILVYSVMMSIFRYTFGVQLPNPFSIFQAR |
| Ga0306925_120411232 | 3300031890 | Soil | MWKLKLIGLLMTIVYGAFSLILVYSVMMSIFRYAFGVQLPNPFSIFQAR |
| Ga0306921_100627173 | 3300031912 | Soil | MWKLKLVGQLMTMVFWMYSLILVYSVMMSIFRYNFGVQLPNPFSIFQAR |
| Ga0306921_109139912 | 3300031912 | Soil | MWKLKLIGLLMTIVYWAFSLILVYSVMMSIFRYAFGVQLPNPFSIFQAR |
| Ga0310901_105786501 | 3300031940 | Soil | MWKLKLIGLLVTIVYWVFSLVLIYSVLMSIFRYAFGVQLPNPFSILQAR |
| Ga0306926_110474521 | 3300031954 | Soil | MWKLKLIGKLMTIVFWVYSLILVYSVMMSNFRYALGVQLPNPFLIFQAR |
| Ga0306926_119019111 | 3300031954 | Soil | MWKLKLIGLLMTIVYWAFSLILVYSVTMSIFRYAFGVQLPNPFAIFQGR |
| Ga0306922_103073682 | 3300032001 | Soil | MWKLKLVGRLMTMVFWMYSLILVYSAMMSIFRYTFGVQLPNPFSIFQAR |
| Ga0306924_119350611 | 3300032076 | Soil | MWKLKLIGLLMTIVYWVFSLLLVYSVMMSIFRYAFGVQLPNPFSIFQAR |
| Ga0306924_119401051 | 3300032076 | Soil | MWKLKLIGLLMTIVYGAFSLILVYSVMMSIFRYAFGVQLP |
| Ga0307471_1024514992 | 3300032180 | Hardwood Forest Soil | MWKLKLIGLLMTIVYWVFSLVLIYSVMMSIFRYAFGVQLPNPFSMFQGP |
| Ga0326723_0558439_1_120 | 3300034090 | Peat Soil | MWKLKLTGLLMTIVFWAYSLILLYSVMMSIFRYAYGVQLP |
| ⦗Top⦘ |