


| Basic Information | |
|---|---|
| Family ID | F097479 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 41 residues |
| Representative Sequence | PFISFKYITDGADEQAHEDWEANLADGIVEFKKKVLDKLQ |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.04 % |
| % of genes from short scaffolds (< 2000 bps) | 87.50 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (38.462 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (26.923 % of family members) |
| Environment Ontology (ENVO) | Unclassified (89.423 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.308 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.82% β-sheet: 0.00% Coil/Unstructured: 66.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF01370 | Epimerase | 14.42 |
| PF02229 | PC4 | 4.81 |
| PF03567 | Sulfotransfer_2 | 4.81 |
| PF05721 | PhyH | 3.85 |
| PF01755 | Glyco_transf_25 | 2.88 |
| PF01555 | N6_N4_Mtase | 1.92 |
| PF08007 | JmjC_2 | 0.96 |
| PF02511 | Thy1 | 0.96 |
| PF07432 | Hc1 | 0.96 |
| PF07963 | N_methyl | 0.96 |
| PF04055 | Radical_SAM | 0.96 |
| PF13353 | Fer4_12 | 0.96 |
| PF12680 | SnoaL_2 | 0.96 |
| PF13578 | Methyltransf_24 | 0.96 |
| PF13450 | NAD_binding_8 | 0.96 |
| PF03767 | Acid_phosphat_B | 0.96 |
| PF01467 | CTP_transf_like | 0.96 |
| PF01408 | GFO_IDH_MocA | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.85 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 2.88 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.92 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.92 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.92 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.96 |
| COG2503 | Predicted secreted acid phosphatase | General function prediction only [R] | 0.96 |
| COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG3700 | Acid phosphatase, class B | Inorganic ion transport and metabolism [P] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.54 % |
| Unclassified | root | N/A | 38.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000200|SI48aug10_150mDRAFT_c1023123 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 568 | Open in IMG/M |
| 3300000201|SI54feb11_135mDRAFT_c1005122 | All Organisms → Viruses → Predicted Viral | 2045 | Open in IMG/M |
| 3300002483|JGI25132J35274_1129055 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300003478|JGI26238J51125_1031494 | All Organisms → Viruses → Predicted Viral | 1176 | Open in IMG/M |
| 3300003620|JGI26273J51734_10042089 | All Organisms → Viruses → Predicted Viral | 1514 | Open in IMG/M |
| 3300005400|Ga0066867_10188549 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 758 | Open in IMG/M |
| 3300005509|Ga0066827_10038404 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
| 3300005521|Ga0066862_10063000 | All Organisms → Viruses → Predicted Viral | 1293 | Open in IMG/M |
| 3300005521|Ga0066862_10087696 | All Organisms → Viruses → Predicted Viral | 1069 | Open in IMG/M |
| 3300005603|Ga0066853_10112328 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300005606|Ga0066835_10054164 | All Organisms → Viruses → Predicted Viral | 1205 | Open in IMG/M |
| 3300006029|Ga0075466_1141346 | Not Available | 625 | Open in IMG/M |
| 3300006090|Ga0082015_1042084 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300006336|Ga0068502_1225273 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 520 | Open in IMG/M |
| 3300006484|Ga0070744_10218728 | Not Available | 540 | Open in IMG/M |
| 3300006735|Ga0098038_1273326 | Not Available | 529 | Open in IMG/M |
| 3300006737|Ga0098037_1215035 | Not Available | 625 | Open in IMG/M |
| 3300006737|Ga0098037_1269484 | Not Available | 542 | Open in IMG/M |
| 3300006789|Ga0098054_1049395 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 1613 | Open in IMG/M |
| 3300006925|Ga0098050_1175388 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300007510|Ga0105013_1163887 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1386 | Open in IMG/M |
| 3300009173|Ga0114996_10139592 | All Organisms → Viruses → Predicted Viral | 2007 | Open in IMG/M |
| 3300009173|Ga0114996_10154518 | All Organisms → cellular organisms → Bacteria | 1887 | Open in IMG/M |
| 3300009449|Ga0115558_1338436 | Not Available | 593 | Open in IMG/M |
| 3300009472|Ga0115554_1376838 | Not Available | 556 | Open in IMG/M |
| 3300009550|Ga0115013_11077949 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 577 | Open in IMG/M |
| 3300009790|Ga0115012_10070213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 2390 | Open in IMG/M |
| 3300010149|Ga0098049_1120309 | Not Available | 817 | Open in IMG/M |
| 3300010151|Ga0098061_1050172 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1628 | Open in IMG/M |
| 3300010151|Ga0098061_1097753 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300010153|Ga0098059_1082256 | All Organisms → Viruses → Predicted Viral | 1284 | Open in IMG/M |
| 3300012928|Ga0163110_11047611 | Not Available | 651 | Open in IMG/M |
| 3300012928|Ga0163110_11492151 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 548 | Open in IMG/M |
| 3300012952|Ga0163180_11415048 | Not Available | 577 | Open in IMG/M |
| 3300012953|Ga0163179_12268746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 502 | Open in IMG/M |
| 3300017714|Ga0181412_1038646 | All Organisms → Viruses → Predicted Viral | 1252 | Open in IMG/M |
| 3300017727|Ga0181401_1122323 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 649 | Open in IMG/M |
| 3300017731|Ga0181416_1146743 | Not Available | 568 | Open in IMG/M |
| 3300017731|Ga0181416_1163920 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 536 | Open in IMG/M |
| 3300017738|Ga0181428_1126742 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 598 | Open in IMG/M |
| 3300017745|Ga0181427_1095589 | Not Available | 726 | Open in IMG/M |
| 3300017748|Ga0181393_1151460 | Not Available | 578 | Open in IMG/M |
| 3300017750|Ga0181405_1021604 | Not Available | 1782 | Open in IMG/M |
| 3300017750|Ga0181405_1037121 | All Organisms → Viruses → Predicted Viral | 1311 | Open in IMG/M |
| 3300017753|Ga0181407_1137118 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 608 | Open in IMG/M |
| 3300017759|Ga0181414_1102087 | Not Available | 754 | Open in IMG/M |
| 3300017762|Ga0181422_1086397 | Not Available | 987 | Open in IMG/M |
| 3300017765|Ga0181413_1039776 | All Organisms → Viruses → Predicted Viral | 1467 | Open in IMG/M |
| 3300017765|Ga0181413_1099272 | Not Available | 887 | Open in IMG/M |
| 3300017767|Ga0181406_1109104 | Not Available | 836 | Open in IMG/M |
| 3300017768|Ga0187220_1092592 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300017786|Ga0181424_10199386 | Not Available | 848 | Open in IMG/M |
| 3300017786|Ga0181424_10263008 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 720 | Open in IMG/M |
| 3300018428|Ga0181568_11008323 | All Organisms → cellular organisms → Bacteria → Deferribacteres → Deferribacteres → Deferribacterales → Deferribacteraceae → Flexistipes → Flexistipes sinusarabici | 633 | Open in IMG/M |
| 3300020175|Ga0206124_10016840 | All Organisms → Viruses → Predicted Viral | 3781 | Open in IMG/M |
| 3300020312|Ga0211542_1063525 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 665 | Open in IMG/M |
| 3300020366|Ga0211489_10060871 | All Organisms → Viruses → Predicted Viral | 1005 | Open in IMG/M |
| 3300020381|Ga0211476_10262316 | Not Available | 596 | Open in IMG/M |
| 3300020403|Ga0211532_10201808 | Not Available | 793 | Open in IMG/M |
| 3300020403|Ga0211532_10350922 | Not Available | 561 | Open in IMG/M |
| 3300020410|Ga0211699_10182943 | Not Available | 797 | Open in IMG/M |
| 3300020416|Ga0211644_10425422 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300020417|Ga0211528_10335151 | Not Available | 563 | Open in IMG/M |
| 3300020422|Ga0211702_10271012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 530 | Open in IMG/M |
| 3300020428|Ga0211521_10370433 | Not Available | 629 | Open in IMG/M |
| 3300020428|Ga0211521_10510868 | Not Available | 514 | Open in IMG/M |
| 3300020436|Ga0211708_10463247 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 520 | Open in IMG/M |
| 3300020438|Ga0211576_10103234 | All Organisms → Viruses → Predicted Viral | 1575 | Open in IMG/M |
| 3300020439|Ga0211558_10063737 | All Organisms → Viruses → Predicted Viral | 1824 | Open in IMG/M |
| 3300020447|Ga0211691_10108736 | Not Available | 1027 | Open in IMG/M |
| 3300020464|Ga0211694_10145055 | Not Available | 958 | Open in IMG/M |
| 3300020470|Ga0211543_10057902 | All Organisms → Viruses → Predicted Viral | 2034 | Open in IMG/M |
| 3300020474|Ga0211547_10163792 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300020475|Ga0211541_10251567 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 865 | Open in IMG/M |
| 3300020475|Ga0211541_10513385 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300020478|Ga0211503_10021024 | All Organisms → Viruses → Predicted Viral | 4371 | Open in IMG/M |
| 3300020595|Ga0206126_10216835 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 886 | Open in IMG/M |
| 3300021958|Ga0222718_10046921 | All Organisms → Viruses → Predicted Viral | 2772 | Open in IMG/M |
| 3300022074|Ga0224906_1171724 | Not Available | 603 | Open in IMG/M |
| 3300022225|Ga0187833_10257170 | Not Available | 991 | Open in IMG/M |
| (restricted) 3300022912|Ga0233430_1004611 | Not Available | 12641 | Open in IMG/M |
| 3300022937|Ga0255770_10440777 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 554 | Open in IMG/M |
| 3300023170|Ga0255761_10194702 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300023175|Ga0255777_10464803 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 663 | Open in IMG/M |
| (restricted) 3300024324|Ga0233443_1043966 | All Organisms → Viruses → Predicted Viral | 1929 | Open in IMG/M |
| 3300025118|Ga0208790_1070969 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
| 3300025120|Ga0209535_1014949 | All Organisms → cellular organisms → Bacteria | 4150 | Open in IMG/M |
| 3300025127|Ga0209348_1089875 | Not Available | 968 | Open in IMG/M |
| 3300025132|Ga0209232_1018564 | All Organisms → Viruses → Predicted Viral | 2758 | Open in IMG/M |
| 3300025151|Ga0209645_1188180 | Not Available | 616 | Open in IMG/M |
| 3300025452|Ga0209046_1092494 | Not Available | 538 | Open in IMG/M |
| 3300025547|Ga0209556_1024861 | All Organisms → Viruses → Predicted Viral | 1741 | Open in IMG/M |
| 3300025870|Ga0209666_1049224 | All Organisms → Viruses → Predicted Viral | 2277 | Open in IMG/M |
| 3300025886|Ga0209632_10575812 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 500 | Open in IMG/M |
| 3300026209|Ga0207989_1089061 | Not Available | 783 | Open in IMG/M |
| 3300026269|Ga0208766_1127318 | Not Available | 679 | Open in IMG/M |
| 3300027780|Ga0209502_10234948 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 823 | Open in IMG/M |
| 3300028489|Ga0257112_10158885 | Not Available | 803 | Open in IMG/M |
| 3300031598|Ga0308019_10391824 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 501 | Open in IMG/M |
| 3300031659|Ga0307986_10322174 | Not Available | 641 | Open in IMG/M |
| 3300032006|Ga0310344_10086958 | Not Available | 2582 | Open in IMG/M |
| 3300032073|Ga0315315_10723813 | Not Available | 910 | Open in IMG/M |
| 3300032820|Ga0310342_100061875 | All Organisms → Viruses → Predicted Viral | 3252 | Open in IMG/M |
| 3300032820|Ga0310342_101348742 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 846 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 26.92% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 21.15% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 18.27% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 6.73% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.85% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.85% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.92% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.92% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.92% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.92% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.92% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.92% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.96% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.96% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.96% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.96% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.96% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.96% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.96% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000200 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 48 08/11/10 150m | Environmental | Open in IMG/M |
| 3300000201 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 135m | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
| 3300003620 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA | Environmental | Open in IMG/M |
| 3300005400 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 | Environmental | Open in IMG/M |
| 3300005509 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV51 | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300005603 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 | Environmental | Open in IMG/M |
| 3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006090 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124 | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007510 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
| 3300020366 | Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX556091-ERR599146) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020422 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300022912 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_150_MG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300023175 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG | Environmental | Open in IMG/M |
| 3300024324 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MG | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025452 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_200m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025547 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026209 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 (SPAdes) | Environmental | Open in IMG/M |
| 3300026269 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300028489 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000m | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SI48aug10_150mDRAFT_10231233 | 3300000200 | Marine | VSFKYITDGADEQAHEDWEANLADGIEVFKDKVLSEIKR* |
| SI54feb11_135mDRAFT_10051221 | 3300000201 | Marine | FKYITDGADEQAHEDWEKNLADGIIEFKERVLDELES* |
| JGI25132J35274_11290551 | 3300002483 | Marine | HHFDVPFISFKYITDGADEQAHEDWENNLANGIVEFKQRILKEIK* |
| JGI26238J51125_10314944 | 3300003478 | Marine | FVSFKYITDGADEQAHEDWEANLADGIEVFKDKVLSEIKR* |
| JGI26273J51734_100420891 | 3300003620 | Marine | YLYGVPFISFKYITDGADEQAHEDWEANLADGIVEFQKKVLDLL* |
| Ga0066867_101885491 | 3300005400 | Marine | PFISFKYITDGADEQAHEDWEKNLADGIEEFKRKVLNGIPK* |
| Ga0066827_100384041 | 3300005509 | Marine | YDIPFISFKYITDGADEQAHEDWEKNLADGIVEFKEKVLEKL* |
| Ga0066862_100630006 | 3300005521 | Marine | ISFKYITDGADEQAHEDWEKNLADGIVEFKEKVLTKIK* |
| Ga0066862_100876961 | 3300005521 | Marine | ISFKYITDGADEQAHEDWEKNLADGIVEFKEKVLTKIT* |
| Ga0066853_101123282 | 3300005603 | Marine | DIPFISFKYITDGADEQSHEDWEKNLANGIVEFKERILEKIE* |
| Ga0066835_100541641 | 3300005606 | Marine | YDIPFISFKYITDGADEQAHEDWEANLEDGIQEFKSQVLSHADIT* |
| Ga0075466_11413461 | 3300006029 | Aqueous | CYLHDVPFISFKYITDGADEQAHEDWEANLANGIVEFKNKVLDLLPKS* |
| Ga0082015_10420842 | 3300006090 | Marine | SFKYITDGADEQSHEDWEKNLANGIVEFKERILEKIE* |
| Ga0068502_12252731 | 3300006336 | Marine | YFNIPFISFKYITDGADEQSHEDWEKNLADGIIVFKDKVLNYVER* |
| Ga0070744_102187284 | 3300006484 | Estuarine | VPFISFKYITDGADEQAHEDWEANLADGIVEFKKKVLDKLKNNS* |
| Ga0098038_12733263 | 3300006735 | Marine | KYITDGADGNAGGDWEENVGKGVVKFKEKVLDKLENNS* |
| Ga0098037_12150351 | 3300006737 | Marine | ITDGADEQANEDWEANLASGIVEFKKKVLDLLPNI* |
| Ga0098037_12694842 | 3300006737 | Marine | ISFKYITDGADEQAHEDWENNLADGIQEFKSQILNHKDIT* |
| Ga0098054_10493954 | 3300006789 | Marine | HYDVPFISFKYITDGADEQAHEDWEKNLSDGIQKFKKKVLVSLS* |
| Ga0098050_11753883 | 3300006925 | Marine | VSFKYITDGADEQAHEDWEANLADGIKEFKKIVLSNIDG* |
| Ga0105013_11638874 | 3300007510 | Marine | HIRKIPFISFKYITDGADEQSHEDWEKNLADGIEEFKRKVLNGIPK* |
| Ga0114996_101395921 | 3300009173 | Marine | KYITDGADEQAHEDWEANLADGIVEFKKKVLDLLQ* |
| Ga0114996_101545181 | 3300009173 | Marine | EKIPFVSFKYITDGADEQAHEDWEKNLADGIVEFKEKVLSVVC* |
| Ga0115558_13384361 | 3300009449 | Pelagic Marine | NYDIPFISFKYITDGADEQAHEDWEANLADGIVEFKKKVLDKLQ* |
| Ga0115554_13768383 | 3300009472 | Pelagic Marine | VPFISFKYITDGADEQAHEDWEANLADGIVEFKKKVLDKLQ* |
| Ga0115013_110779491 | 3300009550 | Marine | DGADEQAHEDWEANLADGIVEFKKKVLDKLPKSS* |
| Ga0115012_100702137 | 3300009790 | Marine | LYDVPFISFKYITDTADPDASNDWEENVGKGIIKFKKEIVCEL* |
| Ga0098049_11203091 | 3300010149 | Marine | YITDGADEQAHEDWEANLADGIVEFKKKVLDKLENNS* |
| Ga0098061_10501724 | 3300010151 | Marine | DGADEQSHEDWEKNLADGIEEFKNKVLSEIPINKE* |
| Ga0098061_10977532 | 3300010151 | Marine | LISVLYITDGADEQSHEDWEKNLANGIVEFKEQILEEL* |
| Ga0098059_10822565 | 3300010153 | Marine | DIPFISFKYITDGADGDANNDWEENVSKGIIEFKKKVLDKLPKSS* |
| Ga0163110_110476114 | 3300012928 | Surface Seawater | PFISFKYITDGADEQAHEDWESNLADGIVEFKKKVLDNL* |
| Ga0163110_114921512 | 3300012928 | Surface Seawater | DIPFVSFKYITDGADEQAHEDWEANLASGIEEFKRQVLNGIQR* |
| Ga0163180_114150481 | 3300012952 | Seawater | NFISFKYITDSADDSAHDDWKANLADGVIEFKKILKNYVV* |
| Ga0163179_122687461 | 3300012953 | Seawater | LYDVPFISFKYITDGADEQAHEDWESNLADGIEIFEEEVLKSL* |
| Ga0181412_10386463 | 3300017714 | Seawater | YLRDIPFVSFKYITDGADEQAHEDWEANLADGIEVFKEKVLKEIQ |
| Ga0181401_11223231 | 3300017727 | Seawater | ISFKYITDGADEQAHEDWEANLADGIEEFKNQVLSEIPR |
| Ga0181416_11467431 | 3300017731 | Seawater | DVPFISFKYITDGADEQAHEDWEANLADGIVEFKEQVLKELI |
| Ga0181416_11639203 | 3300017731 | Seawater | LRGIPFVSFKYITDGADEQAHEDWEANLADGIVVFKEKVLSEIKE |
| Ga0181428_11267421 | 3300017738 | Seawater | ISDGADEDAGVDWEENVGKGIVEFKKKVLDKLPKSS |
| Ga0181427_10955891 | 3300017745 | Seawater | HYDIPFISFKYITDGADEQAREDWENNLADGIQEFKSQVLSHADIT |
| Ga0181393_11514602 | 3300017748 | Seawater | DIPFISFKYITDGADEQAHEDWEKNLADGIQEFQEKILSQITT |
| Ga0181405_10216045 | 3300017750 | Seawater | SFKYITDGADEQAHEDWENNLADGIQEFKSQILSHKDIT |
| Ga0181405_10371213 | 3300017750 | Seawater | PFISFKYITDGADEQAHEDWEANLADGIVEFQKKVLDKLQ |
| Ga0181407_11371183 | 3300017753 | Seawater | YDVPFISFKYITDGADEQAHEDWEANLADGIEVFKAKVLSEIKD |
| Ga0181414_11020871 | 3300017759 | Seawater | YHYDIPFISFKYITDGADEQAHEDWENNLADGIQEFKSQILNHKDIT |
| Ga0181422_10863971 | 3300017762 | Seawater | YGVPFISFKYITDGADEQAHEDWEANLADGIVEFKEKVLDKLQ |
| Ga0181413_10397761 | 3300017765 | Seawater | FKYITDGADEQAHEDWEANLADGIEVFKEKVLSEIKR |
| Ga0181413_10992721 | 3300017765 | Seawater | ISFKYITDGADEQAHEDWENNLADGIQEFKSQILNHKDIT |
| Ga0181406_11091043 | 3300017767 | Seawater | CYHYDIPFISFKYITDGADEQAHEDWENNLADGIQEFKSQILSHKDIT |
| Ga0187220_10925921 | 3300017768 | Seawater | IPFVSFKYITDGADEQAHEDWEVNLADGIEVFKEKVLSEIKR |
| Ga0181424_101993863 | 3300017786 | Seawater | LPIXGRQYDIPFISFKYITDGADEQAHEDWENNLADGIQEFKSQILNHKDIT |
| Ga0181424_102630081 | 3300017786 | Seawater | YITDGADEQAHEDWEANLADGIEVFKEKVLSEIKG |
| Ga0181568_110083233 | 3300018428 | Salt Marsh | VPFISFKYITDGADEQAHEDWEANLSDGIVQFKNQILSEIKXVKKI |
| Ga0206124_100168401 | 3300020175 | Seawater | PFISFKYITDGADEQAHEDWEANLADGIVEFKKKVLDKLQ |
| Ga0211542_10635251 | 3300020312 | Marine | DIPFVSYKYITDGADEQAHEDWEANLADGIKIFRETILDK |
| Ga0211489_100608711 | 3300020366 | Marine | KYITDGADEQAHEDWEANLAQGIEEFHKRVISKID |
| Ga0211476_102623163 | 3300020381 | Marine | DVPFISFKYITDGADEQAHEDWESNLADGIEVFKEKVLAFLPK |
| Ga0211532_102018081 | 3300020403 | Marine | SFKYITDGADEQAHEDWESNLADGIEVFKEKVLAFLPK |
| Ga0211532_103509223 | 3300020403 | Marine | CWEQKIPFVSYKYITDGADEQAHEDWEANLSDGIKVFKEKILNEL |
| Ga0211699_101829434 | 3300020410 | Marine | DVPFISFKYITDGADEQAHEDWESNLADGIEIFEEEVLKSL |
| Ga0211644_104254221 | 3300020416 | Marine | KRQVPFISFKYITDGADEQAHEDWEANLADGIKLFKEKIL |
| Ga0211528_103351511 | 3300020417 | Marine | SFKYITDGADGEANNDWEENVSKGIKVFKEKVLSKLNESD |
| Ga0211702_102710121 | 3300020422 | Marine | SFKYITDGADEQAHEDWESNLADGIEIFEEEVLKSL |
| Ga0211521_103704332 | 3300020428 | Marine | FISFKYITDGADEQANEDWEANLASGIVEFKEKVLRKLNESIG |
| Ga0211521_105108681 | 3300020428 | Marine | SFKYITDGADEQAHEDWENNLADGIQEFKTQILQQIK |
| Ga0211708_104632471 | 3300020436 | Marine | ISFKYITDGADEQAHEDWESNLSEGIKHFQKLVLDNYSHST |
| Ga0211576_101032344 | 3300020438 | Marine | YITDGADEQAHEDWEANLADGIVEFKKKVLDKLKNNS |
| Ga0211558_100637375 | 3300020439 | Marine | HHFDVPFISFKYITDGADEQAHEDWENNLANGIVEFKQRILKEIK |
| Ga0211691_101087361 | 3300020447 | Marine | FISFKYITDGADEQAHEDWEANLADGIEVFKNKILSEFK |
| Ga0211694_101450551 | 3300020464 | Marine | CYLYDIPFISFKYITDGADEQAHEDWEKNLADGIEVFKEKILKELK |
| Ga0211543_100579024 | 3300020470 | Marine | FISFKYITDGADGEANTDWEKNVGKGIVEFKEKVLEEL |
| Ga0211547_101637923 | 3300020474 | Marine | DIPFISFKYITDGADEQAHEDWEKNLADGIEVFKEKILKEIK |
| Ga0211541_102515671 | 3300020475 | Marine | VPFVSFKYITDGADEQAHEDWEVNLADGIEVFKERVLDGIKR |
| Ga0211541_105133851 | 3300020475 | Marine | VCYHCEVPFISFKYITDGADEQAHEDWEANLADGIEVFKEKILKELK |
| Ga0211503_100210249 | 3300020478 | Marine | ISFKYITDGADGEANTDWEKNVGKGIVEFKEKVLEEL |
| Ga0206126_102168353 | 3300020595 | Seawater | FKYITDGADEQAHEDWEANLADGIEVFKEKVLSEIKD |
| Ga0222718_100469215 | 3300021958 | Estuarine Water | YDIPFISFKYITDGADEQAHEDWENNLSDGIVQFKNIVLSEIGK |
| Ga0224906_11717241 | 3300022074 | Seawater | YNVPFISFKYITDGADGNAGGDWEENVGKGVVKFKEKVLDKLENNS |
| Ga0187833_102571701 | 3300022225 | Seawater | ISFKYITDGADEQSHEDWEKNLANGIVEFKERILEKL |
| (restricted) Ga0233430_100461119 | 3300022912 | Seawater | YITDGADEQAHEDWEKNLADGIIEFKERVLDELES |
| Ga0255770_104407772 | 3300022937 | Salt Marsh | KYITDGADEQAHEDWEKNLADGIVQFKNIVLSEIGK |
| Ga0255761_101947021 | 3300023170 | Salt Marsh | LYDVPFISFKYITDGADGNALVDWEENVGKGIVKFKEKVLDKLPKSL |
| Ga0255777_104648031 | 3300023175 | Salt Marsh | ISFKYITDGADEQAHEDWENNLADGIVQFKNIVLSKFDE |
| (restricted) Ga0233443_10439661 | 3300024324 | Seawater | VCYLKDVAFISFKYITDGADEQSHEDWEDNCSDGILEFKEKILTKIR |
| Ga0208790_10709692 | 3300025118 | Marine | CYHYDIPFISFKYITDGADEQSHEDWEKNLANGIVEFKERILDKL |
| Ga0209535_10149497 | 3300025120 | Marine | YLYGVPFISFKYITDGADEQAHEDWEANLADGIVEFKEKVLDKLQ |
| Ga0209348_10898754 | 3300025127 | Marine | KYITDGADEQAHEDWESNLADGIEIFNDKVLKTLK |
| Ga0209232_10185648 | 3300025132 | Marine | VPFISFKYITDGADEQAHEDWEANLADGIEVFKEKILKELK |
| Ga0209645_11881804 | 3300025151 | Marine | KYITDEADGDAGNDWEENVGKGIVEFKKKVLDKLENNS |
| Ga0209046_10924941 | 3300025452 | Marine | KYITDGADEQAHEDWEKNLADGIIEFKERVLDELES |
| Ga0209556_10248611 | 3300025547 | Marine | FKYITDGADEQSHEDWEDNCSDGILEFKEKILTKIR |
| Ga0209666_10492241 | 3300025870 | Marine | YLYGVPFISFKYITDGADEQAHEDWEANLADGIVEFQKKVLDLL |
| Ga0209632_105758122 | 3300025886 | Pelagic Marine | IPFVSFKYITDGADEQAHEDWEANLADGIEVFKEKVLSEIKD |
| Ga0207989_10890611 | 3300026209 | Marine | YDIPFISFKYITDGADEQAHEDWEKNLADGIVEFKEKVLTKIT |
| Ga0208766_11273181 | 3300026269 | Marine | PFISFKYITDDADGNAGDDWEKNVGMGIVKFKEKVLDKLNKN |
| Ga0209502_102349483 | 3300027780 | Marine | LDAVFVSFKYITDGADEQAHEDWEANLADGIEVFKEIVLSEIKR |
| Ga0257112_101588851 | 3300028489 | Marine | YHYDINFISFKYITDGADEQSHEDWEENLADGIVEFKERILEKIE |
| Ga0308019_103918241 | 3300031598 | Marine | KIPFVAFKYITDGADEQAHEDWEANLADGIVVFKENVLNEVKG |
| Ga0307986_103221741 | 3300031659 | Marine | YDVPFISFKYITDGADEQAHEDWEANLADGIIEFKDKILKEIRXEF |
| Ga0310344_100869587 | 3300032006 | Seawater | SFKYISDGADEGANNDWEENVSKGIVEFKERVLSEL |
| Ga0315315_107238134 | 3300032073 | Seawater | KYITDGADEQAHEDWENNLANGIVEFKNQILSKLEINE |
| Ga0310342_1000618756 | 3300032820 | Seawater | FNIPFISFKYITDGADEQSHEDWEKNLADGIIVFKDKVLNYVER |
| Ga0310342_1013487421 | 3300032820 | Seawater | CHIRNVPFISFKYITDGADEQSHDDWEKNLADGIKLFKEQVLNKLYDYSET |
| ⦗Top⦘ |