


| Basic Information | |
|---|---|
| Family ID | F097440 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 21.36 % |
| % of genes near scaffold ends (potentially truncated) | 95.19 % |
| % of genes from short scaffolds (< 2000 bps) | 70.19 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.077 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (8.654 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.462 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (63.462 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 16.28% Coil/Unstructured: 83.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF01761 | DHQ_synthase | 41.35 |
| PF02880 | PGM_PMM_III | 24.04 |
| PF00408 | PGM_PMM_IV | 14.42 |
| PF04545 | Sigma70_r4 | 5.77 |
| PF04546 | Sigma70_ner | 2.88 |
| PF07949 | YbbR | 2.88 |
| PF01545 | Cation_efflux | 1.92 |
| PF01713 | Smr | 1.92 |
| PF13662 | Toprim_4 | 0.96 |
| PF13905 | Thioredoxin_8 | 0.96 |
| PF02457 | DAC | 0.96 |
| PF06723 | MreB_Mbl | 0.96 |
| PF02518 | HATPase_c | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 38.46 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 38.46 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.88 |
| COG4856 | Cyclic di-AMP synthase regulator CdaR, YbbR domain | Signal transduction mechanisms [T] | 2.88 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 1.92 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 1.92 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 1.92 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.04 % |
| Unclassified | root | N/A | 0.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002120|C687J26616_10053486 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
| 3300003324|soilH2_10148514 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300005331|Ga0070670_100809212 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300005331|Ga0070670_100838394 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 831 | Open in IMG/M |
| 3300005332|Ga0066388_100031243 | All Organisms → cellular organisms → Bacteria | 5009 | Open in IMG/M |
| 3300005332|Ga0066388_108403560 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005334|Ga0068869_101564622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300005335|Ga0070666_10056837 | All Organisms → cellular organisms → Bacteria | 2643 | Open in IMG/M |
| 3300005336|Ga0070680_100822566 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005345|Ga0070692_10712624 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 676 | Open in IMG/M |
| 3300005347|Ga0070668_101992254 | All Organisms → cellular organisms → Archaea | 535 | Open in IMG/M |
| 3300005367|Ga0070667_100857561 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300005440|Ga0070705_100009694 | All Organisms → cellular organisms → Bacteria | 4796 | Open in IMG/M |
| 3300005458|Ga0070681_10408002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1270 | Open in IMG/M |
| 3300005544|Ga0070686_100012118 | All Organisms → cellular organisms → Bacteria | 4906 | Open in IMG/M |
| 3300005564|Ga0070664_100048673 | All Organisms → cellular organisms → Bacteria | 3582 | Open in IMG/M |
| 3300005614|Ga0068856_102514517 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005615|Ga0070702_100806210 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300005617|Ga0068859_100295352 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300005841|Ga0068863_101093957 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 801 | Open in IMG/M |
| 3300005843|Ga0068860_100090019 | All Organisms → cellular organisms → Bacteria | 2922 | Open in IMG/M |
| 3300006028|Ga0070717_11503848 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300006046|Ga0066652_100895715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 847 | Open in IMG/M |
| 3300006049|Ga0075417_10450849 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300006358|Ga0068871_100356152 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300006806|Ga0079220_12044913 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica | 512 | Open in IMG/M |
| 3300006852|Ga0075433_10192061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1816 | Open in IMG/M |
| 3300006852|Ga0075433_11381113 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 609 | Open in IMG/M |
| 3300006876|Ga0079217_10196734 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300006880|Ga0075429_100163495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1949 | Open in IMG/M |
| 3300006880|Ga0075429_100180418 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
| 3300006881|Ga0068865_100700438 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 865 | Open in IMG/M |
| 3300006954|Ga0079219_10628487 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 795 | Open in IMG/M |
| 3300006954|Ga0079219_11618872 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 595 | Open in IMG/M |
| 3300006969|Ga0075419_10155777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1496 | Open in IMG/M |
| 3300007004|Ga0079218_13755562 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300009093|Ga0105240_10819626 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300009098|Ga0105245_10362407 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300009101|Ga0105247_10025552 | All Organisms → cellular organisms → Bacteria | 3564 | Open in IMG/M |
| 3300009156|Ga0111538_10037002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 6306 | Open in IMG/M |
| 3300009156|Ga0111538_10189981 | All Organisms → cellular organisms → Bacteria | 2607 | Open in IMG/M |
| 3300009157|Ga0105092_10303498 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300009162|Ga0075423_12608799 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300009174|Ga0105241_10106344 | All Organisms → cellular organisms → Bacteria | 2239 | Open in IMG/M |
| 3300009174|Ga0105241_10465310 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300009174|Ga0105241_12051562 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300009177|Ga0105248_10024469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 6713 | Open in IMG/M |
| 3300009551|Ga0105238_10130168 | All Organisms → cellular organisms → Bacteria | 2495 | Open in IMG/M |
| 3300009553|Ga0105249_11147601 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 848 | Open in IMG/M |
| 3300010040|Ga0126308_10564683 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 773 | Open in IMG/M |
| 3300010041|Ga0126312_10669672 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 748 | Open in IMG/M |
| 3300010045|Ga0126311_10119169 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300010047|Ga0126382_10664179 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300010166|Ga0126306_11142895 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 638 | Open in IMG/M |
| 3300010375|Ga0105239_10454965 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300010399|Ga0134127_10020217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 5146 | Open in IMG/M |
| 3300010399|Ga0134127_10387896 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300010399|Ga0134127_10580512 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300010399|Ga0134127_10650789 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300010399|Ga0134127_10771535 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1008 | Open in IMG/M |
| 3300010399|Ga0134127_11348256 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300011270|Ga0137391_10064230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 3146 | Open in IMG/M |
| 3300012045|Ga0136623_10021297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2760 | Open in IMG/M |
| 3300012093|Ga0136632_10240604 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300012200|Ga0137382_11335057 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300012208|Ga0137376_10725354 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300012354|Ga0137366_10137693 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300012532|Ga0137373_10010776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 9529 | Open in IMG/M |
| 3300012922|Ga0137394_11026605 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300012923|Ga0137359_11489390 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300012986|Ga0164304_10976641 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300013297|Ga0157378_10397385 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
| 3300013308|Ga0157375_10281252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1827 | Open in IMG/M |
| 3300015371|Ga0132258_10298495 | All Organisms → cellular organisms → Bacteria | 3961 | Open in IMG/M |
| 3300015371|Ga0132258_10848255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2305 | Open in IMG/M |
| 3300015373|Ga0132257_100078872 | All Organisms → cellular organisms → Bacteria | 3744 | Open in IMG/M |
| 3300015374|Ga0132255_102286779 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300015374|Ga0132255_105476087 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300017792|Ga0163161_10011294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 6189 | Open in IMG/M |
| 3300018061|Ga0184619_10020761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2697 | Open in IMG/M |
| 3300018061|Ga0184619_10102240 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300018061|Ga0184619_10129552 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300018061|Ga0184619_10493176 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300018429|Ga0190272_10047537 | All Organisms → cellular organisms → Bacteria | 2459 | Open in IMG/M |
| 3300018466|Ga0190268_10333427 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300018466|Ga0190268_11443699 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 593 | Open in IMG/M |
| 3300018920|Ga0190273_11518904 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300019360|Ga0187894_10000827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 41663 | Open in IMG/M |
| 3300019487|Ga0187893_10038490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 5175 | Open in IMG/M |
| 3300021073|Ga0210378_10080159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1278 | Open in IMG/M |
| 3300022534|Ga0224452_1185594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 640 | Open in IMG/M |
| 3300022694|Ga0222623_10279840 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300025899|Ga0207642_10027030 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
| 3300025912|Ga0207707_10000335 | All Organisms → cellular organisms → Bacteria | 49647 | Open in IMG/M |
| 3300025925|Ga0207650_10732694 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300025935|Ga0207709_10660815 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300025936|Ga0207670_10229757 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300025938|Ga0207704_11461670 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300026116|Ga0207674_10000077 | All Organisms → cellular organisms → Bacteria | 104302 | Open in IMG/M |
| 3300027637|Ga0209818_1000011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 47171 | Open in IMG/M |
| 3300027637|Ga0209818_1047612 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300027639|Ga0209387_1000131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 22013 | Open in IMG/M |
| 3300031949|Ga0214473_10025867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 6877 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.65% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 7.69% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.73% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.77% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.85% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.92% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C687J26616_100534861 | 3300002120 | Soil | VAMYIVGQERRLVDPPSQVVAGVRTVTTNMNGRDALPR* |
| soilH2_101485142 | 3300003324 | Sugarcane Root And Bulk Soil | LHGTVVAVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFA |
| Ga0070670_1008092122 | 3300005331 | Switchgrass Rhizosphere | MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFA |
| Ga0070670_1008383941 | 3300005331 | Switchgrass Rhizosphere | QERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFKD* |
| Ga0066388_1000312435 | 3300005332 | Tropical Forest Soil | VGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFST* |
| Ga0066388_1084035601 | 3300005332 | Tropical Forest Soil | MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFA |
| Ga0068869_1015646221 | 3300005334 | Miscanthus Rhizosphere | IVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI* |
| Ga0070666_100568371 | 3300005335 | Switchgrass Rhizosphere | YIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPSAI* |
| Ga0070680_1008225661 | 3300005336 | Corn Rhizosphere | MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF |
| Ga0070692_107126242 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | GQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFKD* |
| Ga0070668_1019922541 | 3300005347 | Switchgrass Rhizosphere | MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPS |
| Ga0070667_1008575612 | 3300005367 | Switchgrass Rhizosphere | MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRP |
| Ga0070705_1000096946 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LHGTGIAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMS |
| Ga0070681_104080022 | 3300005458 | Corn Rhizosphere | LHGTGVAVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVGE* |
| Ga0070686_1000121181 | 3300005544 | Switchgrass Rhizosphere | VAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPSAI* |
| Ga0070664_1000486734 | 3300005564 | Corn Rhizosphere | MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRM |
| Ga0068856_1025145172 | 3300005614 | Corn Rhizosphere | LHGTGIAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDAL |
| Ga0070702_1008062102 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LHGTGVAVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFA |
| Ga0068859_1002953521 | 3300005617 | Switchgrass Rhizosphere | GQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF* |
| Ga0068863_1010939572 | 3300005841 | Switchgrass Rhizosphere | GQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVLM* |
| Ga0068860_1000900194 | 3300005843 | Switchgrass Rhizosphere | GQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAL* |
| Ga0070717_115038482 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFSVALHSTQQDTAQT |
| Ga0066652_1008957151 | 3300006046 | Soil | VAMYIVGQERRLVDPPSQVVAGVRTVTTKNEWARRTPTLSRPFALF* |
| Ga0075417_104508492 | 3300006049 | Populus Rhizosphere | MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPR |
| Ga0068871_1003561521 | 3300006358 | Miscanthus Rhizosphere | GQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFLANSFSS* |
| Ga0079220_120449132 | 3300006806 | Agricultural Soil | MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF |
| Ga0075433_101920613 | 3300006852 | Populus Rhizosphere | MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMS |
| Ga0075433_113811131 | 3300006852 | Populus Rhizosphere | GQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFY* |
| Ga0079217_101967342 | 3300006876 | Agricultural Soil | AGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI* |
| Ga0075429_1001634951 | 3300006880 | Populus Rhizosphere | LLHGTGVAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF* |
| Ga0075429_1001804184 | 3300006880 | Populus Rhizosphere | AVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVYKIP* |
| Ga0068865_1007004381 | 3300006881 | Miscanthus Rhizosphere | VGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVLM* |
| Ga0079219_106284871 | 3300006954 | Agricultural Soil | IAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVGE* |
| Ga0079219_116188721 | 3300006954 | Agricultural Soil | YIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI* |
| Ga0075419_101557773 | 3300006969 | Populus Rhizosphere | YIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVYKIP* |
| Ga0079218_137555621 | 3300007004 | Agricultural Soil | MYIVGQEETVGESSVSVVAGVRTVTTNMNGRDVLPRLSRPFA |
| Ga0105240_108196261 | 3300009093 | Corn Rhizosphere | IAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF* |
| Ga0105245_103624072 | 3300009098 | Miscanthus Rhizosphere | MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPSAI* |
| Ga0105247_100255524 | 3300009101 | Switchgrass Rhizosphere | LHGTGVAVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFK |
| Ga0111538_100370026 | 3300009156 | Populus Rhizosphere | VAMYIVGQERRLVDPPSQVVAGVRTVTTNMNGRDALPRMSRPFAFY* |
| Ga0111538_101899814 | 3300009156 | Populus Rhizosphere | IVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAL* |
| Ga0105092_103034981 | 3300009157 | Freshwater Sediment | MRLAGYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRMSRPF |
| Ga0075423_126087992 | 3300009162 | Populus Rhizosphere | MYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPSMSRPFALSA |
| Ga0105241_101063441 | 3300009174 | Corn Rhizosphere | VGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAL* |
| Ga0105241_104653101 | 3300009174 | Corn Rhizosphere | IVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFIQQPT* |
| Ga0105241_120515621 | 3300009174 | Corn Rhizosphere | MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALP |
| Ga0105242_109975771 | 3300009176 | Miscanthus Rhizosphere | MHQTFLRGMRVAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPR |
| Ga0105248_100244691 | 3300009177 | Switchgrass Rhizosphere | YIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI* |
| Ga0105238_101301681 | 3300009551 | Corn Rhizosphere | VAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAL* |
| Ga0105249_111476011 | 3300009553 | Switchgrass Rhizosphere | IVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVLM* |
| Ga0126308_105646832 | 3300010040 | Serpentine Soil | IVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFALSTIPV* |
| Ga0126312_106696721 | 3300010041 | Serpentine Soil | LVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF* |
| Ga0126311_101191694 | 3300010045 | Serpentine Soil | IVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFALSTIR* |
| Ga0126382_106641792 | 3300010047 | Tropical Forest Soil | LVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFVFLL* |
| Ga0126306_111428952 | 3300010166 | Serpentine Soil | LVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFALSASR* |
| Ga0105239_104549652 | 3300010375 | Corn Rhizosphere | QERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI* |
| Ga0134127_100202171 | 3300010399 | Terrestrial Soil | MYIVGQERRLVNPPSQVVAGVRTVTTKMNGRDALPRMS |
| Ga0134127_103878962 | 3300010399 | Terrestrial Soil | YIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAICNGPW* |
| Ga0134127_105805122 | 3300010399 | Terrestrial Soil | VGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFKD* |
| Ga0134127_106507891 | 3300010399 | Terrestrial Soil | MRVAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRPF |
| Ga0134127_107715352 | 3300010399 | Terrestrial Soil | VGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFIQQPT* |
| Ga0134127_113482563 | 3300010399 | Terrestrial Soil | VGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRPF |
| Ga0137391_100642302 | 3300011270 | Vadose Zone Soil | MRVAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRPFAF* |
| Ga0136623_100212971 | 3300012045 | Polar Desert Sand | MYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF |
| Ga0136632_102406042 | 3300012093 | Polar Desert Sand | MYIAGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFGRAFRLH |
| Ga0137382_113350572 | 3300012200 | Vadose Zone Soil | MYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRP |
| Ga0137376_107253541 | 3300012208 | Vadose Zone Soil | MYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPR |
| Ga0137366_101376933 | 3300012354 | Vadose Zone Soil | VAMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFALLTTRSPTLNP* |
| Ga0137373_100107762 | 3300012532 | Vadose Zone Soil | MYIVGQERRLVNPPSQVVAGVRTVTTNMNGRDALPRMSRPFAFLAAF* |
| Ga0137394_110266051 | 3300012922 | Vadose Zone Soil | MYIVGQEETVGESSVSVVAGVRTVTTNMDGRDVLPRLSRPFAF |
| Ga0137359_114893902 | 3300012923 | Vadose Zone Soil | MYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRMSR |
| Ga0164304_109766411 | 3300012986 | Soil | MYIVGQERRLVNPPSQVVAGVRTVTTNMNGRDVLPR |
| Ga0157378_103973851 | 3300013297 | Miscanthus Rhizosphere | IHVAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRPFAF* |
| Ga0157375_102812523 | 3300013308 | Miscanthus Rhizosphere | GQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI* |
| Ga0132258_102984955 | 3300015371 | Arabidopsis Rhizosphere | VGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFKS* |
| Ga0132258_108482554 | 3300015371 | Arabidopsis Rhizosphere | VGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFLANSFSS* |
| Ga0132257_1000788725 | 3300015373 | Arabidopsis Rhizosphere | IVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPLMSRPFAFKS* |
| Ga0132255_1022867791 | 3300015374 | Arabidopsis Rhizosphere | MYIVGQERRLVDPPSQVVAGVRTVTTNMNGRDALPRMSRPFAFLEAFS |
| Ga0132255_1054760872 | 3300015374 | Arabidopsis Rhizosphere | MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAFLATP |
| Ga0163161_100112946 | 3300017792 | Switchgrass Rhizosphere | MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPSAI |
| Ga0184619_100207611 | 3300018061 | Groundwater Sediment | MRVAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSR |
| Ga0184619_101022401 | 3300018061 | Groundwater Sediment | MRVAMYIVGQEETVGESSVSVVAGVRTVTTNMDGRDVLPRL |
| Ga0184619_101295522 | 3300018061 | Groundwater Sediment | MYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSR |
| Ga0184619_104931762 | 3300018061 | Groundwater Sediment | MYIVGQEETVGESSVSVVAGVRTVTTNMDGRDVLPRL |
| Ga0190272_100475371 | 3300018429 | Soil | VGQERRLVNPPSQVVAGVRTVTTNMNGRDVLPRLSRPFAFFL |
| Ga0190268_103334271 | 3300018466 | Soil | MYIVGQERRLVNPPSQVVAGVRTVTTKMDGRDALPRMS |
| Ga0190268_114436991 | 3300018466 | Soil | IAVYIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAF |
| Ga0190273_115189042 | 3300018920 | Soil | VAMYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDALPRLSRPFAFLIQPF |
| Ga0187894_100008271 | 3300019360 | Microbial Mat On Rocks | MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMS |
| Ga0187893_100384901 | 3300019487 | Microbial Mat On Rocks | MYIVGQERRLVNPPSQVVAGVRTVTTNMNGRDALPRMSRPFAF |
| Ga0210378_100801592 | 3300021073 | Groundwater Sediment | MYIVGQEETAGESSVSVVAGVRTVTTNMDGRDVLPRLSRPFAFITPS |
| Ga0224452_11855941 | 3300022534 | Groundwater Sediment | MYIVGQEETVGESSVSVVAGVRTVTTNMDGRDVLPRLSRPFAFSTAIQTSI |
| Ga0222623_102798402 | 3300022694 | Groundwater Sediment | MYIVGQERRLVNPPSQVVAGVRTVTTNMDGRDVLPRLSRPFA |
| Ga0207642_100270304 | 3300025899 | Miscanthus Rhizosphere | AMYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPSAI |
| Ga0207707_1000033539 | 3300025912 | Corn Rhizosphere | MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFALSANASVLS |
| Ga0207650_107326941 | 3300025925 | Switchgrass Rhizosphere | MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSR |
| Ga0207709_106608152 | 3300025935 | Miscanthus Rhizosphere | MYIVGQEEAVGESSVSVVAGVRTVTTNMDRRDALPRLSRLFAFLSS |
| Ga0207670_102297571 | 3300025936 | Switchgrass Rhizosphere | MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSR |
| Ga0207704_114616702 | 3300025938 | Miscanthus Rhizosphere | MYIVGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRM |
| Ga0207674_1000007782 | 3300026116 | Corn Rhizosphere | MYSVGQERRLVDPPSQVVAGVRTVTTNMDGRDALP |
| Ga0209818_10000111 | 3300027637 | Agricultural Soil | IAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAIYNG |
| Ga0209818_10476121 | 3300027637 | Agricultural Soil | IAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAI |
| Ga0209387_100013117 | 3300027639 | Agricultural Soil | YIAGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRMSRPFAICNG |
| Ga0214473_100258671 | 3300031949 | Soil | VGQERRLVDPPSQVVAGVRTVTTNMDGRDALPRLSRPFAFYA |
| ⦗Top⦘ |