


| Basic Information | |
|---|---|
| Family ID | F097150 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AIQPRVVGPLLHKRGDRVEAISDVWDWFGTPGPLGPGVRELV |
| Number of Associated Samples | 66 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.12 % |
| % of genes from short scaffolds (< 2000 bps) | 94.23 % |
| Associated GOLD sequencing projects | 57 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | environmental samples (36.538 % of family members) |
| NCBI Taxonomy ID | 186616 |
| Taxonomy | All Organisms → Viruses → environmental samples |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (42.308 % of family members) |
| Environment Ontology (ENVO) | Unclassified (89.423 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (96.154 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.57% β-sheet: 0.00% Coil/Unstructured: 81.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF12957 | DUF3846 | 19.23 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.46 % |
| Unclassified | root | N/A | 11.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001460|JGI24003J15210_10077066 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300002231|KVRMV2_101451343 | All Organisms → Viruses → environmental samples → uncultured virus | 811 | Open in IMG/M |
| 3300002482|JGI25127J35165_1073395 | All Organisms → Viruses → environmental samples → uncultured virus | 711 | Open in IMG/M |
| 3300002482|JGI25127J35165_1075641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 697 | Open in IMG/M |
| 3300002482|JGI25127J35165_1096531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 598 | Open in IMG/M |
| 3300002482|JGI25127J35165_1097686 | Not Available | 593 | Open in IMG/M |
| 3300002483|JGI25132J35274_1038255 | All Organisms → Viruses → Predicted Viral | 1068 | Open in IMG/M |
| 3300002488|JGI25128J35275_1114312 | Not Available | 540 | Open in IMG/M |
| 3300006735|Ga0098038_1091283 | All Organisms → Viruses → environmental samples → uncultured virus | 1058 | Open in IMG/M |
| 3300006735|Ga0098038_1114876 | All Organisms → Viruses → environmental samples → uncultured virus | 919 | Open in IMG/M |
| 3300006735|Ga0098038_1120753 | All Organisms → Viruses → environmental samples → uncultured virus | 891 | Open in IMG/M |
| 3300006735|Ga0098038_1161180 | All Organisms → Viruses → environmental samples → uncultured virus | 742 | Open in IMG/M |
| 3300006737|Ga0098037_1176903 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300006737|Ga0098037_1259657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 555 | Open in IMG/M |
| 3300006749|Ga0098042_1067483 | All Organisms → Viruses → environmental samples → uncultured virus | 942 | Open in IMG/M |
| 3300006749|Ga0098042_1068551 | Not Available | 933 | Open in IMG/M |
| 3300006752|Ga0098048_1029980 | Not Available | 1775 | Open in IMG/M |
| 3300006752|Ga0098048_1219695 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300006793|Ga0098055_1285246 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006921|Ga0098060_1214449 | All Organisms → Viruses → environmental samples → uncultured virus | 524 | Open in IMG/M |
| 3300006928|Ga0098041_1105252 | All Organisms → Viruses → environmental samples → uncultured virus | 911 | Open in IMG/M |
| 3300006928|Ga0098041_1242244 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 575 | Open in IMG/M |
| 3300007963|Ga0110931_1153962 | All Organisms → Viruses → environmental samples → uncultured virus | 690 | Open in IMG/M |
| 3300008216|Ga0114898_1232667 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300009703|Ga0114933_10234617 | All Organisms → Viruses → Predicted Viral | 1232 | Open in IMG/M |
| 3300009703|Ga0114933_10388406 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300010148|Ga0098043_1069243 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
| 3300010148|Ga0098043_1213380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 532 | Open in IMG/M |
| 3300012954|Ga0163111_10624970 | All Organisms → Viruses → Predicted Viral | 1008 | Open in IMG/M |
| 3300012954|Ga0163111_10875350 | All Organisms → Viruses → environmental samples → uncultured virus | 860 | Open in IMG/M |
| 3300017717|Ga0181404_1042346 | All Organisms → Viruses → Predicted Viral | 1157 | Open in IMG/M |
| 3300017720|Ga0181383_1116214 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300017728|Ga0181419_1039255 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 1265 | Open in IMG/M |
| 3300017728|Ga0181419_1070630 | All Organisms → Viruses → environmental samples → uncultured virus | 884 | Open in IMG/M |
| 3300017730|Ga0181417_1040416 | All Organisms → Viruses → environmental samples → uncultured virus | 1146 | Open in IMG/M |
| 3300017730|Ga0181417_1081429 | All Organisms → Viruses → environmental samples → uncultured virus | 784 | Open in IMG/M |
| 3300017732|Ga0181415_1058424 | All Organisms → Viruses → environmental samples → uncultured virus | 875 | Open in IMG/M |
| 3300017732|Ga0181415_1090888 | Not Available | 688 | Open in IMG/M |
| 3300017733|Ga0181426_1059596 | All Organisms → Viruses → environmental samples → uncultured virus | 757 | Open in IMG/M |
| 3300017738|Ga0181428_1101444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 673 | Open in IMG/M |
| 3300017738|Ga0181428_1167797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 513 | Open in IMG/M |
| 3300017739|Ga0181433_1012562 | All Organisms → Viruses → Predicted Viral | 2313 | Open in IMG/M |
| 3300017739|Ga0181433_1109768 | All Organisms → Viruses → environmental samples → uncultured virus | 665 | Open in IMG/M |
| 3300017743|Ga0181402_1084608 | All Organisms → Viruses → environmental samples → uncultured virus | 828 | Open in IMG/M |
| 3300017744|Ga0181397_1075366 | All Organisms → Viruses → environmental samples → uncultured virus | 905 | Open in IMG/M |
| 3300017746|Ga0181389_1053556 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300017751|Ga0187219_1143551 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300017756|Ga0181382_1065087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 1027 | Open in IMG/M |
| 3300017756|Ga0181382_1101600 | All Organisms → Viruses → environmental samples → uncultured virus | 778 | Open in IMG/M |
| 3300017757|Ga0181420_1076358 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300017757|Ga0181420_1115663 | All Organisms → Viruses → environmental samples → uncultured virus | 819 | Open in IMG/M |
| 3300017757|Ga0181420_1116714 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 814 | Open in IMG/M |
| 3300017758|Ga0181409_1086191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 943 | Open in IMG/M |
| 3300017759|Ga0181414_1056623 | All Organisms → Viruses → Predicted Viral | 1047 | Open in IMG/M |
| 3300017760|Ga0181408_1145675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 611 | Open in IMG/M |
| 3300017769|Ga0187221_1091302 | All Organisms → Viruses → environmental samples → uncultured virus | 938 | Open in IMG/M |
| 3300017769|Ga0187221_1144563 | Not Available | 706 | Open in IMG/M |
| 3300017772|Ga0181430_1113891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 799 | Open in IMG/M |
| 3300017776|Ga0181394_1159870 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300017781|Ga0181423_1155532 | All Organisms → Viruses → environmental samples → uncultured virus | 880 | Open in IMG/M |
| 3300017782|Ga0181380_1216862 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300017786|Ga0181424_10244114 | All Organisms → Viruses → environmental samples → uncultured virus | 753 | Open in IMG/M |
| 3300017786|Ga0181424_10382888 | All Organisms → Viruses → environmental samples → uncultured virus | 574 | Open in IMG/M |
| 3300017985|Ga0181576_10902878 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300018421|Ga0181592_10868069 | All Organisms → Viruses → environmental samples → uncultured virus | 589 | Open in IMG/M |
| 3300020404|Ga0211659_10250044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 787 | Open in IMG/M |
| 3300020424|Ga0211620_10139953 | Not Available | 1040 | Open in IMG/M |
| 3300020450|Ga0211641_10030824 | All Organisms → cellular organisms → Bacteria | 2913 | Open in IMG/M |
| 3300021373|Ga0213865_10515866 | All Organisms → Viruses → environmental samples → uncultured virus | 507 | Open in IMG/M |
| 3300021379|Ga0213864_10209431 | Not Available | 990 | Open in IMG/M |
| 3300022074|Ga0224906_1053207 | All Organisms → Viruses → Predicted Viral | 1292 | Open in IMG/M |
| 3300022074|Ga0224906_1077060 | All Organisms → Viruses → environmental samples → uncultured virus | 1015 | Open in IMG/M |
| 3300022074|Ga0224906_1109484 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 808 | Open in IMG/M |
| 3300022074|Ga0224906_1173878 | All Organisms → Viruses → environmental samples → uncultured virus | 598 | Open in IMG/M |
| 3300023119|Ga0255762_10587428 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300025070|Ga0208667_1051804 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300025086|Ga0208157_1060105 | All Organisms → Viruses → environmental samples → uncultured virus | 995 | Open in IMG/M |
| 3300025102|Ga0208666_1061604 | All Organisms → Viruses → Predicted Viral | 1016 | Open in IMG/M |
| 3300025102|Ga0208666_1064863 | All Organisms → Viruses → environmental samples → uncultured virus | 979 | Open in IMG/M |
| 3300025102|Ga0208666_1075395 | All Organisms → Viruses → environmental samples → uncultured virus | 879 | Open in IMG/M |
| 3300025110|Ga0208158_1047331 | All Organisms → Viruses → environmental samples → uncultured virus | 1064 | Open in IMG/M |
| 3300025112|Ga0209349_1111913 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 768 | Open in IMG/M |
| 3300025127|Ga0209348_1036421 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 1733 | Open in IMG/M |
| 3300025127|Ga0209348_1047149 | All Organisms → Viruses → Predicted Viral | 1469 | Open in IMG/M |
| 3300025127|Ga0209348_1087780 | All Organisms → Viruses → environmental samples → uncultured virus | 983 | Open in IMG/M |
| 3300025127|Ga0209348_1110063 | All Organisms → Viruses → environmental samples → uncultured virus | 846 | Open in IMG/M |
| 3300025128|Ga0208919_1072308 | All Organisms → Viruses → environmental samples → uncultured virus | 1144 | Open in IMG/M |
| 3300025128|Ga0208919_1204368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 591 | Open in IMG/M |
| 3300025132|Ga0209232_1075329 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300025141|Ga0209756_1146941 | All Organisms → Viruses → environmental samples → uncultured virus | 953 | Open in IMG/M |
| 3300025141|Ga0209756_1232173 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium | 686 | Open in IMG/M |
| 3300025141|Ga0209756_1264787 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300025151|Ga0209645_1077659 | All Organisms → Viruses → Predicted Viral | 1109 | Open in IMG/M |
| 3300025151|Ga0209645_1118305 | All Organisms → Viruses → environmental samples → uncultured virus | 843 | Open in IMG/M |
| 3300025151|Ga0209645_1139401 | All Organisms → Viruses | 756 | Open in IMG/M |
| 3300028022|Ga0256382_1120856 | Not Available | 629 | Open in IMG/M |
| 3300028448|Ga0256383_113049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → unclassified Pseudomonadales → Pseudomonadales bacterium | 671 | Open in IMG/M |
| 3300029309|Ga0183683_1005905 | All Organisms → Viruses | 3644 | Open in IMG/M |
| 3300029787|Ga0183757_1023663 | All Organisms → Viruses → Predicted Viral | 1410 | Open in IMG/M |
| 3300029787|Ga0183757_1034196 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
| 3300029792|Ga0183826_1022630 | All Organisms → Viruses → Predicted Viral | 1009 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 42.31% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 35.58% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.73% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.88% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.88% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.92% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.92% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.92% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.92% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.96% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020424 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300028039 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 2300m | Environmental | Open in IMG/M |
| 3300028448 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 300m | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300029792 | Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24003J15210_100770661 | 3300001460 | Marine | AIQPRVVGPLLYIKGGWVEAISDVWDWFGTPGPLGPGVRELV* |
| KVRMV2_1004628165 | 3300002231 | Marine Sediment | AIQPKVVGPLFAKRGDRVKKSLDFWIWSGTPGALAPGGES* |
| KVRMV2_1014513434 | 3300002231 | Marine Sediment | FSIHECVNLAILPRVVGPLLQKRGDGPQLIIDFWIWFGTPDPLGSGVFI* |
| JGI25127J35165_10733953 | 3300002482 | Marine | EYVFTRYNYLNQAIQPTVVGPLFVKRGDPSQLIIDFWIWFGTPGALAPGARS* |
| JGI25127J35165_10756413 | 3300002482 | Marine | QAIQPRVVGPLFTKRGDRVEAINDVWDWFGTHGALAPWVRELVSPSVKGVFFN* |
| JGI25127J35165_10965313 | 3300002482 | Marine | RYNCLNQAIQPTVVGPLFVKRGDPAQLIIDFWIWFGTPGPLGPGARS* |
| JGI25127J35165_10976863 | 3300002482 | Marine | IHECVNHAIQPVVVGPLCTKKGGGAQLIIDFWIWFGTPGALAPGAER* |
| JGI25132J35274_10382554 | 3300002483 | Marine | NQAIQPRVVGPLFTKKGDRVAAQPVIEIWFGTPGALAPGVES* |
| JGI25128J35275_11143121 | 3300002488 | Marine | CVNLAIQPTVVGPLCTKRGDGPQLIIDFWIWFGTPGALAPGVFIC* |
| Ga0098038_10912831 | 3300006735 | Marine | AIQPRVVGPLLHKRGDRVEAISDVWDWFGTPGPLGPGVRELI* |
| Ga0098038_11148761 | 3300006735 | Marine | IQPRVVGPLCTKRGDRVEAIIYIGIWFGTPGPLGPGVRELV* |
| Ga0098038_11207531 | 3300006735 | Marine | QAIQPRVVGPLFTKRGDRVEAINDVWDWFGTPGALAPGVES* |
| Ga0098038_11611801 | 3300006735 | Marine | AIQPRVVGPLCTKRGDRVEAIIYIGIWFGTPGPLGPGVRELI* |
| Ga0098037_11769031 | 3300006737 | Marine | AILPRVVGPLLQKRGDGIQLIIDFWVWFGTPDPLGSGVFI* |
| Ga0098037_12596573 | 3300006737 | Marine | AIQPRVVGPLFTKRGDRVKVIIYVWDWFGTPGPLGPGVES* |
| Ga0098042_10674831 | 3300006749 | Marine | AIQPRVVGPLFTKKGGWVEAIIYIEIWFGTPGPLGPGVES* |
| Ga0098042_10685514 | 3300006749 | Marine | AIQPVVVGPLLHKRGDRVLFILDVWIWFGTPGALAPGVES* |
| Ga0098048_10299801 | 3300006752 | Marine | AIQPRVVGPLLYKRGDRVKKINDVWDWFGTPGALAPGVRELCCPDF* |
| Ga0098048_12196951 | 3300006752 | Marine | NSVNQAIQPRVVGPLFTKKGDRVAAQPVIEIWFGTPGALAPGVRE* |
| Ga0098055_12852463 | 3300006793 | Marine | NQAIQPRVVGPLFTKRGDRVAAQPEIETWFGTPGPLGPGVRELI* |
| Ga0075467_106876391 | 3300006803 | Aqueous | NQAIQPRVVGPLFVKRGDRVLYILDVWNLFGTPGP* |
| Ga0098060_12144493 | 3300006921 | Marine | AIQPRVVGPLLHKRGNRVEAINDVWDWFGTPGALAPGVRE* |
| Ga0098041_11052524 | 3300006928 | Marine | AIQPRVVGPLFVKRGDRVLFIFDVWIWFGTPGPLGPGGES* |
| Ga0098041_12422441 | 3300006928 | Marine | AIQPKVVGPLLCKRGDGVATQPIIEIWFGTHGALAPWVES* |
| Ga0110931_11539621 | 3300007963 | Marine | NQAIQPRVVGPLCTKRGDRVEAISDVWIWFGTPGPLGPGAES* |
| Ga0114898_12326671 | 3300008216 | Deep Ocean | NSVNQAIQPRVVGPLFTKRGHRVEAIIYIGIWFGTPGALAPGVRELI* |
| Ga0114933_102346171 | 3300009703 | Deep Subsurface | CVNLAILPRVVGPLLQKRGDGPQLIIDFWIWFGTPDPLGSGVFI* |
| Ga0114933_103884061 | 3300009703 | Deep Subsurface | NQAIQPRVVGPLFAKRGHRVEAIIYIGIWFGTHGALAPWVRELV* |
| Ga0098043_10692434 | 3300010148 | Marine | RYNCLNQAIQPRVVGPLLHKRGAGVKVYLYVWDWSGTPGALAPGVRELI* |
| Ga0098043_12133801 | 3300010148 | Marine | VVGPLLHKRGDGVATQPMIEIWFGTHGALAPWVES* |
| Ga0163111_106249705 | 3300012954 | Surface Seawater | AIQPRVVGPLLHKRGDRVEAISDVWDWFGTPGPLGPGVRELV* |
| Ga0163111_108753504 | 3300012954 | Surface Seawater | AIQPRVVGPLLHKRGDRVEAISDVWDWFGTPGALAPGCYVYYY* |
| Ga0181404_10423465 | 3300017717 | Seawater | IQPRVVGPLLYKRGDRVEAIIYIGIWFGTPGPLGPGVRELVSLVRPCIV |
| Ga0181383_11162141 | 3300017720 | Seawater | AIQPRVVGPLLYKRGDRVEAISGVWDWFGTHGPLGPWVRELV |
| Ga0181419_10392555 | 3300017728 | Seawater | QPRVVGPLLHKRGDRVEAINDVWDWFGTPGPLGPGVES |
| Ga0181419_10706304 | 3300017728 | Seawater | AIQPRVVGPLLYKKGDRVEAISDVWIWFGTPGPLGPGVRELI |
| Ga0181417_10404165 | 3300017730 | Seawater | AIQPRVVGPLLYKKGGWVEAISDVWDWFGTPGALAPGVRELV |
| Ga0181417_10814294 | 3300017730 | Seawater | AIQPRVVGPLCTKRGDRVLFNLYVWDLFGTPGPLGPGAES |
| Ga0181415_10584241 | 3300017732 | Seawater | AIQPRVVGPLLYKKGDRVEAISDVWIWFGTPGPLGPGVES |
| Ga0181415_10908881 | 3300017732 | Seawater | AIQPRVVGPLLYKRGDRVEAIIYIGIWFGTPGPLGPGVRELVSLVRPCIV |
| Ga0181426_10595963 | 3300017733 | Seawater | IQPRVVGPLLHKRGDRVEAISDVWDWFGTPGPLGPGVRELV |
| Ga0181428_11014443 | 3300017738 | Seawater | IQPRVVGPLFVKRGHRVEAISDVWNWFGTHGALAPWVLCLL |
| Ga0181428_11677971 | 3300017738 | Seawater | QPRVVGPLFTKRGDRVEAISDVWDWFGTPGPNGPGVRELVSPSIKGVFFY |
| Ga0181433_10125621 | 3300017739 | Seawater | YVFTSYNCLNQAIQPRVVGPLCTKRGDRVLFNLYVWDLFGTPGPLGPGRES |
| Ga0181433_11097683 | 3300017739 | Seawater | IQPRVVGPLLYKKGGWVEAISDVWDWFGTPGALAPGVRELV |
| Ga0181402_10846081 | 3300017743 | Seawater | KAIQPRVVGPLCTKKGDRVKAIIYIGIWLGTPGPLGPGVRELV |
| Ga0181397_10753664 | 3300017744 | Seawater | IQPRVVGPLFTKRGDGVAIQLEIEICFGTHGALAPWVES |
| Ga0181389_10535561 | 3300017746 | Seawater | IQPRVVGPLYTKKGGWVEAISDVWDWFGTPGPLGPGVES |
| Ga0187219_11435511 | 3300017751 | Seawater | QPRVVGPLLYIKGGWVEAISDVWDWFGTPGPLGPGVRELV |
| Ga0181382_10650871 | 3300017756 | Seawater | AIQPRVVGPLFVKRGHRVEAIIYIGIWFGTHGALAPWVES |
| Ga0181382_11016001 | 3300017756 | Seawater | RAIQPRVVGPLLYKKGGWVEAISDVWDWFGTPGALAPGVRELV |
| Ga0181420_10763581 | 3300017757 | Seawater | QPRVVGPLLYKRGDRVEAIIYIGIWFGTPGPLGPGVRELVSLVRPCIV |
| Ga0181420_11156631 | 3300017757 | Seawater | SCLNQAIQPRVVGPLLYKKGGWVEAISDVWDWFGTPGALAPGVRELV |
| Ga0181420_11167144 | 3300017757 | Seawater | RAIQPRVVGPLFTKRGGPAQLIIDFWIWFGTPGPLGPGVRELI |
| Ga0181409_10861911 | 3300017758 | Seawater | RKRAIQPRVVGPLFTKRGHRVEAIIYIGIWFGTHGALAPWVES |
| Ga0181414_10566234 | 3300017759 | Seawater | KAIQPRVVGPLLHKRGDRVEAISGVWDWLGTPGPLGPGVRELVSLVRPCIV |
| Ga0181408_11456751 | 3300017760 | Seawater | IQPRVVGPLLQKKRDRVKKINDVWDWFGTHGALAPWVRELVSPSVKGVFFN |
| Ga0187221_10913021 | 3300017769 | Seawater | QPRVVGPLLHKRGDRVEAIIYIGIWFGTPGALAPGERRVS |
| Ga0187221_11445631 | 3300017769 | Seawater | QAIQPRVVGPLLYKRGDRVEAIIYIGIWFGTPGPLGPGVRELVSLVRPCIV |
| Ga0181430_11138911 | 3300017772 | Seawater | IQPRVVGPLFTKRGHRVEAIIYIGIWFGTHGALAPWVES |
| Ga0181394_11598701 | 3300017776 | Seawater | QPRVVGPLLHKRGDGVAAQPVIETWFGTPGPLGPGVRELI |
| Ga0181423_11555321 | 3300017781 | Seawater | AIQPRVVGPLLHKRGDRVEAISGVWDWLGTPGPLGPGVRELVSLVRPCIV |
| Ga0181380_12168621 | 3300017782 | Seawater | ALQPRVVGPLLHKRGDGVAAQPVIETWFGTPGPLGPGVRELI |
| Ga0181424_102441141 | 3300017786 | Seawater | KRGDRVEAISGVWDWLGTPGPNGPGVRELVSLVRPCIV |
| Ga0181424_103828881 | 3300017786 | Seawater | IQPRVVGPLLYKRGDRVKAISGVWDWFGTHGPLGPWVRELV |
| Ga0181576_109028783 | 3300017985 | Salt Marsh | AIQPRVVGPLFTKRGDRVLKNFYVWDWFGTPGPLGPGWKGRF |
| Ga0181592_108680693 | 3300018421 | Salt Marsh | AIQPRVVGPLLHKKGDRVEAISDVWDWFGTPGPLGPGVRELV |
| Ga0211659_102500444 | 3300020404 | Marine | AIQPRVVGPLLYKKGDGVEAINDVWIWFGTPGPLGPGVRELI |
| Ga0211620_101399533 | 3300020424 | Marine | RYNYLNQAIQPTVVGPLFTKRGDPAQLIIDFWIWFGTPGPLGPGARS |
| Ga0211641_100308248 | 3300020450 | Marine | NQAIQPRVVGPLCTKRGDRVLFNLYVWDLFGTPGALAPGVES |
| Ga0213865_105158661 | 3300021373 | Seawater | QPRVVGPLLHKKGDRVEAISDVWDWFGTPGPLGPGVRELV |
| Ga0213864_102094315 | 3300021379 | Seawater | KCVKLAIQPRVVGPLFAKRGDRVKVYLDFWIWFGTPGPLGPGVES |
| Ga0224906_10532071 | 3300022074 | Seawater | PRVVGPLLYKRGDRVEAIIYIGIWFGTPGPLGPGVRELVSLVRPCIV |
| Ga0224906_10770601 | 3300022074 | Seawater | PRVVGPLLHKKGGWVAIQLEIEIWFGTPGALAPGAES |
| Ga0224906_11094841 | 3300022074 | Seawater | PRVVGPLLHKRGDRVEAINDVWDWFGTPGPLGPGVES |
| Ga0224906_11738783 | 3300022074 | Seawater | YNCLNQAIQPRVVGPLLYKRGDRIQLTIDFWIWFGTPGALAPGVES |
| Ga0255762_105874283 | 3300023119 | Salt Marsh | AIQPRVVGPLFTKKGDRVLKNFYVWDWFGTPGALAPGVRELI |
| Ga0208667_10518043 | 3300025070 | Marine | VNQAIQPRVVGPLFTKRGDRVAAQPEIETWFGTPGPLGPGVRELI |
| Ga0208157_10601054 | 3300025086 | Marine | AIQPRVVGPLFTKRGDRVKVIIYVWDWFGTPGPLGPGVES |
| Ga0208666_10616045 | 3300025102 | Marine | AIQPRVVGPLCTKRGDRVEAIIYIGIWFGTPGPLGPGVRELI |
| Ga0208666_10648634 | 3300025102 | Marine | AIQPRVVGPLLHKRGDRVEAISDVWDWFGTPGALAPGCYVYYY |
| Ga0208666_10753951 | 3300025102 | Marine | AIQPRVVGPLCTKRGDRVEAIIYIGIWFGTPGPLGPGVRELV |
| Ga0208158_10473311 | 3300025110 | Marine | AIQPRVVGPLFTKRGDRVAAQPVIEIWFGTPGALAPGVRS |
| Ga0209349_11119131 | 3300025112 | Marine | QAIQPRVVGPLLHKRGDRVEAIIYIGIWFGTHGPLGPWVRELI |
| Ga0209348_10364211 | 3300025127 | Marine | AILPRVVGPLCTKRGDGPQLIIDFWIWLGTPDPLGSGVVHMILV |
| Ga0209348_10471495 | 3300025127 | Marine | AIQPTVVGPLFVKRGDPAQLIIDFWIWSGTPGPLGPGARS |
| Ga0209348_10877801 | 3300025127 | Marine | TSYNSINQAIQPRVVGPLFVKRGDGVAIQPVIEIWLGTPGPLGPGVRELV |
| Ga0209348_11100631 | 3300025127 | Marine | AIQPRVVGPLFAKRGDRVKKSLDFWIWSGTPGALAPGVRELFSPTV |
| Ga0208919_10723081 | 3300025128 | Marine | VNQAIQPRVVGPLFTKRGDRVKVIIYVWDWFGTPGPLGPGVES |
| Ga0208919_12043683 | 3300025128 | Marine | IQPRVVGPLLAIRGDRVKAINDVWDWFGTHGALAPWVES |
| Ga0209232_10753293 | 3300025132 | Marine | AILPRVVGPLLQKRGDGIQLIIDFWIWFGTPDPLGSGVFI |
| Ga0209756_11469415 | 3300025141 | Marine | RVVGPLFTKRGDGVAIQPVIEIWFGTPGALAPGVES |
| Ga0209756_12321733 | 3300025141 | Marine | IQPRVVGPLLRKRGDRVLFILYTWDLFGTPGALAPGHYVYY |
| Ga0209756_12647873 | 3300025141 | Marine | AIQPRVVGPLFTKRGDGVAIQPVIEIWFGTPGALAPGVRELI |
| Ga0209645_10776591 | 3300025151 | Marine | NSVNQAIQPRVVGPLLHKKGDRVEAINDVWIWLGTPGALAPGAES |
| Ga0209645_11183053 | 3300025151 | Marine | NSVNQAIQPRVVGPLFTKKGDRVAAQPVIEIWFGTPGALAPGVES |
| Ga0209645_11394013 | 3300025151 | Marine | NSVNQAIQPRVVGPLFTKKGDRVAAQPVIEIWFGTHGALAPWVESN |
| Ga0256382_11208563 | 3300028022 | Seawater | NAILPRVVGPLLQKRGDGLQLIIDFWIWFGTPDPLGSGVFI |
| Ga0256380_10187401 | 3300028039 | Seawater | QPKVVGPLFAKRGDRVKVYLDFWIWSGTPGALAPGGES |
| Ga0256383_1130491 | 3300028448 | Seawater | EGRRAILPRVVGPLLQKRGDGPQLIIDFWIWFGTPDPLGSGVFI |
| Ga0183683_10059051 | 3300029309 | Marine | VFTSYNCLNQAIQPRVVGPLFAKRGDGVKVYLDYWFWIGTPGPLGPGARS |
| Ga0183757_10236636 | 3300029787 | Marine | QPRVVGPLFTKRGDRVKAINDVWDWLGTPSGWQCPFPPGVRELVSPSIKGVFFY |
| Ga0183757_10341964 | 3300029787 | Marine | NSVNQAIQPRVVGPLLHKRGNRVEAISDVWNWFGTHGALAPWVES |
| Ga0183826_10226301 | 3300029792 | Marine | VFTSYNSVNQAIQPRVVGPLYVQRGDRVLLIIYIWICFGTPGALAPGVVHM |
| ⦗Top⦘ |