


| Basic Information | |
|---|---|
| Family ID | F097121 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MNGFFDIKSPNWLGGVNVHNTLALVGIGFLVYKAMKK |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 18.27 % |
| % of genes from short scaffolds (< 2000 bps) | 53.85 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (47.115 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (19.231 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.923 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.692 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.46% β-sheet: 0.00% Coil/Unstructured: 61.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00534 | Glycos_transf_1 | 12.50 |
| PF06414 | Zeta_toxin | 6.73 |
| PF00535 | Glycos_transf_2 | 4.81 |
| PF13578 | Methyltransf_24 | 2.88 |
| PF13692 | Glyco_trans_1_4 | 1.92 |
| PF13392 | HNH_3 | 1.92 |
| PF13489 | Methyltransf_23 | 1.92 |
| PF09524 | Phg_2220_C | 1.92 |
| PF01541 | GIY-YIG | 0.96 |
| PF11195 | DUF2829 | 0.96 |
| PF01555 | N6_N4_Mtase | 0.96 |
| PF10111 | Glyco_tranf_2_2 | 0.96 |
| PF00132 | Hexapep | 0.96 |
| PF04383 | KilA-N | 0.96 |
| PF02767 | DNA_pol3_beta_2 | 0.96 |
| PF13443 | HTH_26 | 0.96 |
| PF00892 | EamA | 0.96 |
| PF01464 | SLT | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.96 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.96 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.88 % |
| Unclassified | root | N/A | 47.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000405|LV_Brine_h2_0102DRAFT_1000535 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum | 13175 | Open in IMG/M |
| 3300000558|Draft_10274976 | All Organisms → cellular organisms → Bacteria | 4520 | Open in IMG/M |
| 3300000882|FwDRAFT_10183648 | Not Available | 556 | Open in IMG/M |
| 3300000929|NpDRAFT_10412175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1201 | Open in IMG/M |
| 3300002408|B570J29032_109003613 | Not Available | 564 | Open in IMG/M |
| 3300002408|B570J29032_109739235 | All Organisms → Viruses → Predicted Viral | 1175 | Open in IMG/M |
| 3300002408|B570J29032_109742736 | Not Available | 1184 | Open in IMG/M |
| 3300002408|B570J29032_109946914 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4425 | Open in IMG/M |
| 3300005512|Ga0074648_1000206 | All Organisms → cellular organisms → Bacteria | 77527 | Open in IMG/M |
| 3300005517|Ga0070374_10422412 | Not Available | 669 | Open in IMG/M |
| 3300005527|Ga0068876_10026771 | Not Available | 3611 | Open in IMG/M |
| 3300005581|Ga0049081_10000213 | All Organisms → cellular organisms → Bacteria | 22939 | Open in IMG/M |
| 3300005581|Ga0049081_10122671 | Not Available | 961 | Open in IMG/M |
| 3300005662|Ga0078894_10066506 | All Organisms → cellular organisms → Bacteria | 3101 | Open in IMG/M |
| 3300005662|Ga0078894_10117781 | Not Available | 2360 | Open in IMG/M |
| 3300005662|Ga0078894_11672179 | Not Available | 523 | Open in IMG/M |
| 3300005942|Ga0070742_10014167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Tijeunavirus → Tijeunavirus TJE1 | 2089 | Open in IMG/M |
| 3300006752|Ga0098048_1010523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 3280 | Open in IMG/M |
| 3300007216|Ga0103961_1035812 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 6345 | Open in IMG/M |
| 3300007542|Ga0099846_1094354 | Not Available | 1105 | Open in IMG/M |
| 3300007634|Ga0102901_1205613 | Not Available | 554 | Open in IMG/M |
| 3300007973|Ga0105746_1000224 | All Organisms → cellular organisms → Bacteria | 15455 | Open in IMG/M |
| 3300007973|Ga0105746_1159524 | Not Available | 762 | Open in IMG/M |
| 3300008267|Ga0114364_1013353 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 5670 | Open in IMG/M |
| 3300008267|Ga0114364_1016671 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 3164 | Open in IMG/M |
| 3300009049|Ga0102911_1234669 | Not Available | 515 | Open in IMG/M |
| 3300009059|Ga0102830_1099377 | Not Available | 863 | Open in IMG/M |
| 3300009082|Ga0105099_10299624 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Schleiferiaceae → Croceimicrobium → Croceimicrobium hydrocarbonivorans | 942 | Open in IMG/M |
| 3300009151|Ga0114962_10003363 | Not Available | 12989 | Open in IMG/M |
| 3300009151|Ga0114962_10118382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1627 | Open in IMG/M |
| 3300009152|Ga0114980_10186852 | Not Available | 1221 | Open in IMG/M |
| 3300009154|Ga0114963_10205430 | Not Available | 1138 | Open in IMG/M |
| 3300009154|Ga0114963_10306920 | Not Available | 882 | Open in IMG/M |
| 3300009155|Ga0114968_10016591 | All Organisms → cellular organisms → Bacteria | 5148 | Open in IMG/M |
| 3300009155|Ga0114968_10057572 | All Organisms → cellular organisms → Bacteria | 2479 | Open in IMG/M |
| 3300009155|Ga0114968_10223954 | Not Available | 1080 | Open in IMG/M |
| 3300009168|Ga0105104_10737136 | Not Available | 568 | Open in IMG/M |
| 3300009181|Ga0114969_10581814 | Not Available | 616 | Open in IMG/M |
| 3300009183|Ga0114974_10002403 | Not Available | 14360 | Open in IMG/M |
| 3300009496|Ga0115570_10403146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 581 | Open in IMG/M |
| 3300009526|Ga0115004_10308947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 938 | Open in IMG/M |
| 3300009684|Ga0114958_10577965 | Not Available | 538 | Open in IMG/M |
| 3300010160|Ga0114967_10439342 | Not Available | 645 | Open in IMG/M |
| 3300010316|Ga0136655_1037036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1563 | Open in IMG/M |
| 3300010389|Ga0136549_10009872 | All Organisms → cellular organisms → Bacteria | 6459 | Open in IMG/M |
| 3300010885|Ga0133913_10417999 | Not Available | 3543 | Open in IMG/M |
| 3300011268|Ga0151620_1088467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 985 | Open in IMG/M |
| 3300011268|Ga0151620_1151444 | Not Available | 713 | Open in IMG/M |
| 3300012346|Ga0157141_1004746 | Not Available | 2238 | Open in IMG/M |
| 3300012667|Ga0157208_10000018 | Not Available | 52379 | Open in IMG/M |
| 3300013004|Ga0164293_10108112 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 2124 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10095406 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1903 | Open in IMG/M |
| 3300017968|Ga0181587_10304237 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 1074 | Open in IMG/M |
| 3300018603|Ga0192881_1002260 | Not Available | 1603 | Open in IMG/M |
| 3300019784|Ga0181359_1006558 | All Organisms → cellular organisms → Bacteria | 3894 | Open in IMG/M |
| 3300019784|Ga0181359_1018052 | All Organisms → cellular organisms → Bacteria | 2642 | Open in IMG/M |
| 3300020347|Ga0211504_1004808 | All Organisms → Viruses → Predicted Viral | 4763 | Open in IMG/M |
| 3300020498|Ga0208050_1003111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 2149 | Open in IMG/M |
| 3300020532|Ga0208601_1003608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 2476 | Open in IMG/M |
| 3300020573|Ga0208485_1010413 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2093 | Open in IMG/M |
| 3300021093|Ga0194123_10043853 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3019 | Open in IMG/M |
| 3300021438|Ga0213920_1005976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4340 | Open in IMG/M |
| 3300021961|Ga0222714_10021737 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 4988 | Open in IMG/M |
| 3300022190|Ga0181354_1066937 | Not Available | 1192 | Open in IMG/M |
| 3300022407|Ga0181351_1174775 | Not Available | 746 | Open in IMG/M |
| 3300022752|Ga0214917_10002285 | Not Available | 23584 | Open in IMG/M |
| 3300022752|Ga0214917_10090279 | All Organisms → Viruses → Predicted Viral | 1830 | Open in IMG/M |
| 3300023174|Ga0214921_10520763 | Not Available | 558 | Open in IMG/M |
| 3300023184|Ga0214919_10690317 | Not Available | 581 | Open in IMG/M |
| (restricted) 3300023276|Ga0233410_10057482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 1170 | Open in IMG/M |
| 3300023301|Ga0209414_1004012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 6328 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10333149 | Not Available | 713 | Open in IMG/M |
| 3300025759|Ga0208899_1068735 | Not Available | 1427 | Open in IMG/M |
| 3300025818|Ga0208542_1041187 | Not Available | 1467 | Open in IMG/M |
| 3300025874|Ga0209533_1011080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 7008 | Open in IMG/M |
| 3300027142|Ga0255065_1084171 | Not Available | 538 | Open in IMG/M |
| 3300027151|Ga0255063_1002778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Tijeunavirus → Tijeunavirus TJE1 | 4335 | Open in IMG/M |
| 3300027586|Ga0208966_1015097 | Not Available | 2288 | Open in IMG/M |
| 3300027693|Ga0209704_1251200 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300027697|Ga0209033_1091003 | Not Available | 1015 | Open in IMG/M |
| 3300027708|Ga0209188_1005011 | Not Available | 8627 | Open in IMG/M |
| 3300027712|Ga0209499_1024667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2732 | Open in IMG/M |
| 3300027749|Ga0209084_1310856 | Not Available | 590 | Open in IMG/M |
| 3300027759|Ga0209296_1006510 | All Organisms → cellular organisms → Bacteria | 7348 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10800047 | Not Available | 501 | Open in IMG/M |
| 3300027963|Ga0209400_1081611 | Not Available | 1558 | Open in IMG/M |
| 3300028392|Ga0304729_1006314 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 6045 | Open in IMG/M |
| 3300028394|Ga0304730_1181695 | Not Available | 814 | Open in IMG/M |
| 3300031758|Ga0315907_10228435 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300032401|Ga0315275_11897112 | Not Available | 630 | Open in IMG/M |
| 3300033981|Ga0334982_0474338 | Not Available | 557 | Open in IMG/M |
| 3300033995|Ga0335003_0009300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 5102 | Open in IMG/M |
| 3300034012|Ga0334986_0010720 | All Organisms → cellular organisms → Bacteria | 6576 | Open in IMG/M |
| 3300034012|Ga0334986_0209888 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300034061|Ga0334987_0004858 | Not Available | 12850 | Open in IMG/M |
| 3300034061|Ga0334987_0329785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 997 | Open in IMG/M |
| 3300034064|Ga0335001_0172153 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 1217 | Open in IMG/M |
| 3300034073|Ga0310130_0000159 | All Organisms → cellular organisms → Bacteria | 58498 | Open in IMG/M |
| 3300034093|Ga0335012_0338461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 752 | Open in IMG/M |
| 3300034096|Ga0335025_0038072 | All Organisms → cellular organisms → Bacteria | 3221 | Open in IMG/M |
| 3300034104|Ga0335031_0739463 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium | 559 | Open in IMG/M |
| 3300034122|Ga0335060_0373539 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 761 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 19.23% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.38% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 4.81% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.88% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.88% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.88% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.92% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.92% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.92% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.92% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.92% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.92% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.92% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.92% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 1.92% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.96% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.96% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.96% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.96% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.96% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.96% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.96% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.96% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.96% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.96% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.96% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.96% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012346 | Freshwater microbial communities from Emily Creek, Ontario, Canada - S29 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018603 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782239-ERR1711906) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020532 | Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020573 | Freshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300023276 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MG | Environmental | Open in IMG/M |
| 3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LV_Brine_h2_0102DRAFT_100053523 | 3300000405 | Hypersaline | MNDLFDIQSPNYLGGNNVHNTLALLGIGFLVYCAVKKK* |
| Draft_102749763 | 3300000558 | Hydrocarbon Resource Environments | MGAGFFDIKSPNWLGGNNVHNTLILVGVAYLVYKSM* |
| FwDRAFT_101836481 | 3300000882 | Freshwater And Marine | MGQGFLDIKSPNWLGGNNVHNTLIIAGVAFLVYKAMKK* |
| NpDRAFT_104121752 | 3300000929 | Freshwater And Marine | MDGLFDIKSSKWLGGNNVHNTLALVGIALLVYKAYK* |
| B570J29032_1090036131 | 3300002408 | Freshwater | MGDFLNIKSPKYLGGVNVHNTLALAGIAYLVWKAYK* |
| B570J29032_1097392352 | 3300002408 | Freshwater | MFQGFFDIKSDKWLGGVNVHNTLTLVGIGILVFKAMKK* |
| B570J29032_1097427362 | 3300002408 | Freshwater | MFQGFFDIKSDKWLGGVNVHNTLALIGIGYLVVKAWKK* |
| B570J29032_1099469142 | 3300002408 | Freshwater | MGDLLNIKSPKYLGGVNVHNTLALAGIAYLVWKAYSK* |
| Ga0074648_100020627 | 3300005512 | Saline Water And Sediment | MNGFFDIKSANWLGGVNVHNTVTIALLAYLVYKNR* |
| Ga0070374_104224121 | 3300005517 | Freshwater Lake | MGTGFLDIKSPNWLGGNNVHNTLALIGIGYLVFKAMKK* |
| Ga0068876_100267712 | 3300005527 | Freshwater Lake | MGSGFFDIKSPNWLGGNNVHNTLIILGVGYLVFKSLKK* |
| Ga0049081_1000021327 | 3300005581 | Freshwater Lentic | MGTGFLDIKSPNWLGGNNVHNTLIIAGVAFLVYKAMKK* |
| Ga0049081_101226712 | 3300005581 | Freshwater Lentic | MSGFLDIKSPNYLGGVNVHNTLALLGIGYLVYKAMKK* |
| Ga0078894_100665068 | 3300005662 | Freshwater Lake | MGSGFFDIKSPNWLGGNNVHNTLIILGVGYLVYKAMRK* |
| Ga0078894_101177812 | 3300005662 | Freshwater Lake | MGTGFLDIKSPNWLGGNNVHNTLIIAGVAYLVWKAMKK* |
| Ga0078894_116721791 | 3300005662 | Freshwater Lake | MGTGFFDIKSPNWLGGVNVHNTLALLGIGFLVFKAMKKA* |
| Ga0070742_100141671 | 3300005942 | Estuarine | MNGFFDIKSPNWLGGVNVHNTVTIALLAYLVYKNR* |
| Ga0098048_10105238 | 3300006752 | Marine | MDNLFDIKSSNWLGGNNVHNTLALVGIALLVYKAYK* |
| Ga0103961_10358128 | 3300007216 | Freshwater Lake | MEGFFDIKSPNWLGGNNVHNTVIILGVGYLVWKAWSK* |
| Ga0099846_10943541 | 3300007542 | Aqueous | NGFFDIKSANWLGGVNVHNTVTIALLAYLVYKNR* |
| Ga0102901_12056133 | 3300007634 | Estuarine | LTYKKMTGFFDIKSPNWLGGTNVHNTLALIGIAYLVYKTAK* |
| Ga0105746_10002243 | 3300007973 | Estuary Water | MSGFFDIKSPNWLGGVNVHNTLALIGIGYLVYKAMRK* |
| Ga0105746_11595241 | 3300007973 | Estuary Water | SGFFDIKSPNWLGGNNVHNTLIILGVGYLVFKSLKK* |
| Ga0114364_10133539 | 3300008267 | Freshwater, Plankton | MFQGFFDIKSDKWLGGVNVHNTLALLGIGYLVYKAMKK* |
| Ga0114364_10166714 | 3300008267 | Freshwater, Plankton | MGTGFFDIKSPNWLGGVNVHNTLALLGIGFLVFKAMKKG* |
| Ga0102911_12346691 | 3300009049 | Estuarine | KKMTGFFDIKSPNWLGGTNVHNTLALIGIAYLVYKTAK* |
| Ga0102830_10993772 | 3300009059 | Estuarine | MGTGFLDIKSPNWLGGNNVHNTLIIAGVAFLVWKAMKK* |
| Ga0105099_102996242 | 3300009082 | Freshwater Sediment | MGAGFFDIKSANWLGGNNVHNTLIIAGVAFLVYKAYKK* |
| Ga0114962_100033638 | 3300009151 | Freshwater Lake | MTGVLDIKSPNWLFGNNVHNTLIILGVGFLVWKAVKK* |
| Ga0114962_101183824 | 3300009151 | Freshwater Lake | MGAGFFDIKSPNWLGGTNVHNTLALVGIGYLVYKAWGK* |
| Ga0114980_101868522 | 3300009152 | Freshwater Lake | MAQGFFDIKSPNWLGGVNVHNTLALVGIYFLVYKAMKK* |
| Ga0114963_102054302 | 3300009154 | Freshwater Lake | MLNGFLDIKSDKWLGGVNVHNTLALLGIGYLVFKAMKK* |
| Ga0114963_103069202 | 3300009154 | Freshwater Lake | MGAGFFDIKSPNWLGGTNVHNTLALVGFGYLVYKAWGK* |
| Ga0114968_100165915 | 3300009155 | Freshwater Lake | MGTGYFDIKSPNWLGGVNVHNTLALIGIGFLVFKALKK* |
| Ga0114968_100575722 | 3300009155 | Freshwater Lake | MKDGFLDIKSPNWLGGVNVHNTLALIGIGFLVFKAWKK* |
| Ga0114968_102239542 | 3300009155 | Freshwater Lake | MEGLFDIKSPNWLGGVNVHNTLALVGIGYLVYKAWKS* |
| Ga0105104_107371362 | 3300009168 | Freshwater Sediment | MGSGFFDIKSPNWLGGNNVHNTIIILGVGYLVYKAWGK* |
| Ga0114969_105818142 | 3300009181 | Freshwater Lake | MGDLFNIKSANYLGGVNVHNTLALAGIAYLVYKAYSK* |
| Ga0114974_100024033 | 3300009183 | Freshwater Lake | MSDFFNIKSPNYLGGVNVHNTLALAGIAYLVYKAYK* |
| Ga0115570_104031462 | 3300009496 | Pelagic Marine | MDGVFDIKSTNWLGGNNVHNTLALVGIALLVYKAYK* |
| Ga0115004_103089472 | 3300009526 | Marine | MTGLFDIKSPNWLGGNNVHNTLALAGIGFLVFKALKK* |
| Ga0114958_105779651 | 3300009684 | Freshwater Lake | MKQGFFDISSPSWLGGVNVHNTLALLGIGFLVYKAVKK* |
| Ga0114967_104393422 | 3300010160 | Freshwater Lake | MGFSLDIKSPDYLGGVNFHNTVTIALLAFLVYKAVKK* |
| Ga0136655_10370363 | 3300010316 | Freshwater To Marine Saline Gradient | MNGFFDIKSANWLGGVNVHNTITIALLAYLVYKNR* |
| Ga0136549_100098724 | 3300010389 | Marine Methane Seep Sediment | MQGLFDIKSDNWLGGNNVHNTLTIAMLAFLVYKQVKK* |
| Ga0133913_104179992 | 3300010885 | Freshwater Lake | MGSDFFNIKSPNWLGGTNVHNTLALVGIYYLVYKAYTK* |
| Ga0151620_10884671 | 3300011268 | Freshwater | LNLKAMGNGFFDIKSPNWLGGNNAHNTLIILGVGYLVFKSLKK* |
| Ga0151620_11514443 | 3300011268 | Freshwater | FLDIKSPNWLGGNNVHNTLIIAGVAFLVWKAMKK* |
| Ga0157141_10047461 | 3300012346 | Freshwater | MGAGFFDIKSANWLGGNNVHNTLIIAGVAFLVYKAYKR* |
| Ga0157208_1000001881 | 3300012667 | Freshwater | MGAGFFDIKSANWLGGVNVHNTVTIGLLAFLVYKAVKK* |
| Ga0164293_101081122 | 3300013004 | Freshwater | MGAGFFDIKSPNWLGGNNVHNTLIILGVAFLVYKAAK* |
| (restricted) Ga0172365_100954062 | 3300013127 | Sediment | MGDFFNIKSDKWLGGVNVHNTLALVGIYYLVYKAWSK* |
| (restricted) Ga0172364_105394582 | 3300013129 | Sediment | MKDLFNINSDKWLGGNNVHNTVIILGVGYLVFKAWSKK* |
| (restricted) Ga0172362_106907612 | 3300013133 | Sediment | MKDLFNINSDKWLGGNNVHNTVIILGVGYLVFKAWS |
| Ga0181587_103042373 | 3300017968 | Salt Marsh | MNGFFDIKSANWLGGVNVHNTVTIALLAYLVYKNR |
| Ga0192881_10022604 | 3300018603 | Marine | IMDGLFDIKSSNWLGGNNVHNTLALVGIALLVYKAYK |
| Ga0181359_10065581 | 3300019784 | Freshwater Lake | MGTGFLDIKSPNWLGGNNVHNTLIIAGVAFLVYKAMKK |
| Ga0181359_10180523 | 3300019784 | Freshwater Lake | MGAGFFDIKSPNWLGGTNVHNTLALVGIGYLVYKAMAK |
| Ga0211504_10048083 | 3300020347 | Marine | MDGLFDIKSSNWLGGNNVHNTLALVGIALLVYKAYK |
| Ga0208050_10031112 | 3300020498 | Freshwater | MGTGFLDIKSPNWLGGNNVHNTLIIAGVAFLVWKAMKK |
| Ga0208601_10036082 | 3300020532 | Freshwater | MGDLLNIKSPKYLGGVNVHNTLALAGIAYLVWKAYSK |
| Ga0208485_10104131 | 3300020573 | Freshwater | MGDLLNIKSPKYLGGVNVHNTLALAGIAYLVWKAYK |
| Ga0194123_100438532 | 3300021093 | Freshwater Lake | MGDFFNIKSDKWLGGVNVHNTLALIGIYYLVYKAWSK |
| Ga0213920_10059764 | 3300021438 | Freshwater | MGAGFFDIKSPNWLGGTNVHNTLALIGIGYLVYKAWGK |
| Ga0222714_100217372 | 3300021961 | Estuarine Water | MGSGFFDIKSPNWLGGNNVHNTLIILGVGYLVFKSLKK |
| Ga0181354_10669371 | 3300022190 | Freshwater Lake | NSKIMFQGFFDIKSDKWLGGVNVHNTLALIGIGYLVVKAWKK |
| Ga0181351_11747752 | 3300022407 | Freshwater Lake | MGDLFNIKSANYLGGVNVHNTLALAGIAYLVYKAYSK |
| Ga0214917_100022854 | 3300022752 | Freshwater | MNGFFDIKSPNWLGGVNVHNTLALVGIGFLVYKAMKK |
| Ga0214917_100902792 | 3300022752 | Freshwater | MGTGFFDIKSPNWLGGNNVHNTLIILGVGYLVFKAYKG |
| Ga0214921_105207632 | 3300023174 | Freshwater | MGTGFFDIKSPNWLGGVNVHNTLALVGIGFLVFKALKK |
| Ga0214919_106903171 | 3300023184 | Freshwater | MSGFLDIKSPNYLGGVNVHNTLALLGIGYLVYKAMKK |
| (restricted) Ga0233410_100574822 | 3300023276 | Seawater | MTGLFDIKSPNWLGGNNVHNTLALAGIGFLVFKALKK |
| Ga0209414_10040128 | 3300023301 | Hypersaline | MNDLFDIQSPNYLGGNNVHNTLALLGIGFLVYCAVKKK |
| (restricted) Ga0255046_103331491 | 3300024519 | Seawater | IMDGLFDIKSTNWLGGNNVHNTLALVGIALLVYKAYK |
| Ga0208899_10687353 | 3300025759 | Aqueous | KLMNGFFDIKSANWLGGVNVHNTITIALLAYLVYKNR |
| Ga0208542_10411871 | 3300025818 | Aqueous | MNGFFDIKSANWLGGVNVHNTITIALLAYLVYKNR |
| Ga0209533_101108014 | 3300025874 | Pelagic Marine | MDGVFDIKSTKWLGGNNVHNTLALVGIALLVYKAYK |
| Ga0255065_10841711 | 3300027142 | Freshwater | GFLDIKSPNWLGGNNVHNTLIIAGVAFLVYKAMKK |
| Ga0255063_10027783 | 3300027151 | Freshwater | MNGFFDIKSPNWLGGVNVHNTVTIALLAYLVYKNR |
| Ga0208966_10150972 | 3300027586 | Freshwater Lentic | MGTGFLDIKSPNWLGGNNVHNTLALIGIGYLVFKAMKK |
| Ga0209704_12512002 | 3300027693 | Freshwater Sediment | MGAGFFDIKSANWLGGTNVHNTLALLGIGYLVFKAYKK |
| Ga0209033_10910032 | 3300027697 | Freshwater Lake | PLNVEIMQSGFFDIKSPNWLGGNNVHNTLVILGVGFLVYKAWKK |
| Ga0209188_100501116 | 3300027708 | Freshwater Lake | MTGVLDIKSPNWLFGNNVHNTLIILGVGFLVWKAVKK |
| Ga0209499_10246673 | 3300027712 | Freshwater Lake | MGAGFFDIKSPNWLGGTNVHNTLALVGIGYLVYKAWGK |
| Ga0209084_13108563 | 3300027749 | Freshwater Lake | GAGFFDIKSPNWLGGTNVHNTLALVGIGYLVYKAWGK |
| Ga0209296_10065102 | 3300027759 | Freshwater Lake | MGNGFFDIKSPNWLGGNNVHNTIIILGVGYLVYKAWGK |
| (restricted) Ga0255055_108000471 | 3300027881 | Seawater | DGLFDIKSTNWLGGNNVHNTLALVGIALLVYKAYK |
| Ga0209400_10816112 | 3300027963 | Freshwater Lake | MGTGYFDIKSPNWLGGVNVHNTLALIGIGFLVFKALKK |
| Ga0304729_100631410 | 3300028392 | Freshwater Lake | MLNGFLDIKSDKWLGGVNVHNTLALLGIGYLVFKAMKK |
| Ga0304730_11816951 | 3300028394 | Freshwater Lake | MKDGFLDIKSPNWLGGVNVHNTLALIGIGFLVFKAWKK |
| Ga0315907_102284352 | 3300031758 | Freshwater | MGFSLDIKSPDYLGGVNFHNTVTIALLAFLVYKAVKK |
| Ga0315275_118971122 | 3300032401 | Sediment | AMGSGFFDIKSPNWLGGNNVHNTLIILGVGYLVFKSLKK |
| Ga0334982_0474338_311_418 | 3300033981 | Freshwater | MKEFFNINSDKWLGGVNVHNTITIALLAYLVYKNR |
| Ga0335003_0009300_4124_4234 | 3300033995 | Freshwater | MSDFLNIKSPNYLGGVNVHNTLALAGIAYLVYKAYK |
| Ga0334986_0010720_4911_5018 | 3300034012 | Freshwater | MKEFFNINSDKWLGGVNVHNTITIALLGYIVYKLR |
| Ga0334986_0209888_735_851 | 3300034012 | Freshwater | MFQGFFDIKSDKWLGGVNVHNTLALIGIGYLVFKAMKK |
| Ga0334987_0004858_2355_2462 | 3300034061 | Freshwater | MGDFFNINSDKWLGGVNVHNTITIALLAYLVYKNR |
| Ga0334987_0329785_622_729 | 3300034061 | Freshwater | MQDFFNINSDKWLGGVNVHNTITIALLAYLVYKTR |
| Ga0335001_0172153_931_1044 | 3300034064 | Freshwater | MGDFFNIKSDKWLGGVNVHNTLALVGIYYLVYKAWGK |
| Ga0310130_0000159_53984_54091 | 3300034073 | Fracking Water | MGDFFNINSDKWLGGVNVHNTITIALLGYLVYKLR |
| Ga0335012_0338461_640_750 | 3300034093 | Freshwater | MSDFFNIKSPNYLGGVNVHNTLALAGIAYLVYKAYK |
| Ga0335025_0038072_2257_2373 | 3300034096 | Freshwater | MGAGFFDIKSANWLGGVNVHNTLTISLLAFLVYKVVKK |
| Ga0335031_0739463_1_105 | 3300034104 | Freshwater | MFQGFFDIKSDKWLGGVNVHNTLALIGIGYLVVKA |
| Ga0335060_0373539_2_106 | 3300034122 | Freshwater | MGSGFFDIKSPNWLGGNNVHNTLIILGVGYLVFKS |
| ⦗Top⦘ |