


| Basic Information | |
|---|---|
| Family ID | F097079 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 45 residues |
| Representative Sequence | IGPPCYVPRVTDAALLERLQGQMEQELRRLYGVARDALVRRG |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.27 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.038 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.846 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.962 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.038 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.43% β-sheet: 0.00% Coil/Unstructured: 58.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF08447 | PAS_3 | 13.46 |
| PF01075 | Glyco_transf_9 | 9.62 |
| PF08448 | PAS_4 | 3.85 |
| PF00535 | Glycos_transf_2 | 1.92 |
| PF13188 | PAS_8 | 0.96 |
| PF07578 | LAB_N | 0.96 |
| PF13426 | PAS_9 | 0.96 |
| PF11937 | DUF3455 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 9.62 |
| COG3952 | Uncharacterized N-terminal domain of lipid-A-disaccharide synthase | General function prediction only [R] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.04 % |
| Unclassified | root | N/A | 0.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001084|JGI12648J13191_1012041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 837 | Open in IMG/M |
| 3300001867|JGI12627J18819_10371871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 579 | Open in IMG/M |
| 3300005181|Ga0066678_10189811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1307 | Open in IMG/M |
| 3300005184|Ga0066671_10339195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 951 | Open in IMG/M |
| 3300005186|Ga0066676_10471756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 851 | Open in IMG/M |
| 3300005335|Ga0070666_11469396 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005439|Ga0070711_100242551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1410 | Open in IMG/M |
| 3300005450|Ga0066682_10277686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1080 | Open in IMG/M |
| 3300005530|Ga0070679_100744147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 923 | Open in IMG/M |
| 3300005533|Ga0070734_10445644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 738 | Open in IMG/M |
| 3300005538|Ga0070731_10517948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300005566|Ga0066693_10323311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 618 | Open in IMG/M |
| 3300005591|Ga0070761_10155894 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300005764|Ga0066903_100280618 | All Organisms → cellular organisms → Bacteria | 2611 | Open in IMG/M |
| 3300005921|Ga0070766_11130217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300006755|Ga0079222_11455933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300006797|Ga0066659_10258673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1307 | Open in IMG/M |
| 3300006800|Ga0066660_10884190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 728 | Open in IMG/M |
| 3300006806|Ga0079220_10855854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300009545|Ga0105237_10349630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1483 | Open in IMG/M |
| 3300009820|Ga0105085_1043939 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300009826|Ga0123355_11977128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300010044|Ga0126310_10936105 | Not Available | 678 | Open in IMG/M |
| 3300010361|Ga0126378_10429765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1434 | Open in IMG/M |
| 3300010376|Ga0126381_100969131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1226 | Open in IMG/M |
| 3300011120|Ga0150983_12695775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 914 | Open in IMG/M |
| 3300012198|Ga0137364_10205646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1444 | Open in IMG/M |
| 3300012917|Ga0137395_10909176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 636 | Open in IMG/M |
| 3300012927|Ga0137416_10450695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1100 | Open in IMG/M |
| 3300012930|Ga0137407_10558204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1072 | Open in IMG/M |
| 3300012931|Ga0153915_11538777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 778 | Open in IMG/M |
| 3300012975|Ga0134110_10319356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 674 | Open in IMG/M |
| 3300013105|Ga0157369_10339445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1561 | Open in IMG/M |
| 3300015372|Ga0132256_100393983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1486 | Open in IMG/M |
| 3300016270|Ga0182036_10450844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1011 | Open in IMG/M |
| 3300016294|Ga0182041_11505089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 620 | Open in IMG/M |
| 3300016341|Ga0182035_11089588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 710 | Open in IMG/M |
| 3300016404|Ga0182037_10513684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1006 | Open in IMG/M |
| 3300016422|Ga0182039_11306187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 657 | Open in IMG/M |
| 3300017927|Ga0187824_10003685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4175 | Open in IMG/M |
| 3300017930|Ga0187825_10130876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 880 | Open in IMG/M |
| 3300017947|Ga0187785_10260822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 781 | Open in IMG/M |
| 3300018034|Ga0187863_10172506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1205 | Open in IMG/M |
| 3300018058|Ga0187766_10194435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1279 | Open in IMG/M |
| 3300018086|Ga0187769_10096152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2123 | Open in IMG/M |
| 3300020170|Ga0179594_10127853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 929 | Open in IMG/M |
| 3300020583|Ga0210401_10373757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1287 | Open in IMG/M |
| 3300020583|Ga0210401_11452241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 543 | Open in IMG/M |
| 3300021168|Ga0210406_10364374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1164 | Open in IMG/M |
| 3300021178|Ga0210408_10042937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3543 | Open in IMG/M |
| 3300021180|Ga0210396_10273671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1499 | Open in IMG/M |
| 3300021181|Ga0210388_10719828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 869 | Open in IMG/M |
| 3300021402|Ga0210385_11070232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300021405|Ga0210387_11322550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300021432|Ga0210384_10393855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1248 | Open in IMG/M |
| 3300021444|Ga0213878_10288901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 702 | Open in IMG/M |
| 3300021476|Ga0187846_10269977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 705 | Open in IMG/M |
| 3300021477|Ga0210398_11329812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300021560|Ga0126371_11043318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 958 | Open in IMG/M |
| 3300022467|Ga0224712_10501126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 587 | Open in IMG/M |
| 3300025914|Ga0207671_10291473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1288 | Open in IMG/M |
| 3300026296|Ga0209235_1279949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 510 | Open in IMG/M |
| 3300026330|Ga0209473_1088158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1303 | Open in IMG/M |
| 3300026333|Ga0209158_1342269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300026547|Ga0209156_10337139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 662 | Open in IMG/M |
| 3300027853|Ga0209274_10215631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 978 | Open in IMG/M |
| 3300027879|Ga0209169_10377986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 745 | Open in IMG/M |
| 3300027986|Ga0209168_10149206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1186 | Open in IMG/M |
| 3300028536|Ga0137415_11279984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300028906|Ga0308309_10651699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 915 | Open in IMG/M |
| 3300031507|Ga0307509_10260343 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
| 3300031549|Ga0318571_10402410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300031564|Ga0318573_10463236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 682 | Open in IMG/M |
| 3300031668|Ga0318542_10153696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1145 | Open in IMG/M |
| 3300031708|Ga0310686_114145568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 543 | Open in IMG/M |
| 3300031715|Ga0307476_10062718 | All Organisms → cellular organisms → Bacteria | 2559 | Open in IMG/M |
| 3300031720|Ga0307469_11238995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 706 | Open in IMG/M |
| 3300031720|Ga0307469_12367044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 518 | Open in IMG/M |
| 3300031740|Ga0307468_101211193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 681 | Open in IMG/M |
| 3300031740|Ga0307468_102423813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 512 | Open in IMG/M |
| 3300031744|Ga0306918_10407818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1059 | Open in IMG/M |
| 3300031753|Ga0307477_10893882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 586 | Open in IMG/M |
| 3300031778|Ga0318498_10455965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 565 | Open in IMG/M |
| 3300031782|Ga0318552_10154579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1153 | Open in IMG/M |
| 3300031792|Ga0318529_10065839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1590 | Open in IMG/M |
| 3300031794|Ga0318503_10253001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 571 | Open in IMG/M |
| 3300031819|Ga0318568_10690023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 635 | Open in IMG/M |
| 3300031823|Ga0307478_10322119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1269 | Open in IMG/M |
| 3300031831|Ga0318564_10460569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 553 | Open in IMG/M |
| 3300031831|Ga0318564_10517988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 517 | Open in IMG/M |
| 3300031832|Ga0318499_10129458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 982 | Open in IMG/M |
| 3300031835|Ga0318517_10122995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1149 | Open in IMG/M |
| 3300031942|Ga0310916_10551377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 981 | Open in IMG/M |
| 3300031945|Ga0310913_10051444 | All Organisms → cellular organisms → Bacteria | 2690 | Open in IMG/M |
| 3300032001|Ga0306922_12338109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300032008|Ga0318562_10439952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 757 | Open in IMG/M |
| 3300032035|Ga0310911_10816353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 539 | Open in IMG/M |
| 3300032044|Ga0318558_10269127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 840 | Open in IMG/M |
| 3300032051|Ga0318532_10286277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 585 | Open in IMG/M |
| 3300032068|Ga0318553_10007421 | All Organisms → cellular organisms → Bacteria | 4654 | Open in IMG/M |
| 3300032180|Ga0307471_100434091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1449 | Open in IMG/M |
| 3300032180|Ga0307471_101046826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 982 | Open in IMG/M |
| 3300033290|Ga0318519_10675204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 631 | Open in IMG/M |
| 3300033807|Ga0314866_033435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 800 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.88% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.96% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.96% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.96% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.96% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.96% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12648J13191_10120411 | 3300001084 | Forest Soil | PYYVPRVTDSAILARLQGEMEQELRRLYGVARAALRAPGRAAG* |
| JGI12627J18819_103718711 | 3300001867 | Forest Soil | CYVPRVTDAAELGRWQERMEKELKRLFGVARAALEGDSVN* |
| Ga0066678_101898112 | 3300005181 | Soil | FSRIAIAIGPPYYVPRVSDASSLARLQSQMEQELKRLYGVARAALHPG* |
| Ga0066671_103391952 | 3300005184 | Soil | IAIGPPCYVPRVTDPPSLARLQSQMEQELKRLYGVARAALCRD* |
| Ga0066676_104717562 | 3300005186 | Soil | PFSRIAIAIGPPCYVPRVSDASSLARLQSQMEQELKRLYGVARAALHPD* |
| Ga0070666_114693962 | 3300005335 | Switchgrass Rhizosphere | FVIPVPFSRVAIAIGPPRYVPRTTAAAGVESLQGEMEQELKRLYGVAQDALGKR* |
| Ga0070711_1002425511 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | IGPPCYVPRVTDAATLEQLQGKMEEELRRLFAVARQALQRGR* |
| Ga0066682_102776861 | 3300005450 | Soil | AIAIGPPCYVPRVTDPPSLARLQSQMEQELKRLYGVARAALCRD* |
| Ga0070679_1007441471 | 3300005530 | Corn Rhizosphere | VIPVPFSRVAIAIGPPRYVPRTTGAGIESLQGEMEQELERLYRVARDALAKR* |
| Ga0070734_104456441 | 3300005533 | Surface Soil | FSRVAIAIGPPRYVPRTSSAGGIEALQGEMEQELKRLYGVARDALVKP* |
| Ga0070731_105179482 | 3300005538 | Surface Soil | FLARIAIAIGPPRYVARVNGAAGLAQLQGEMERELHRVYGVARDALGRQR* |
| Ga0066693_103233111 | 3300005566 | Soil | ARVALAIGPPRYVPRVTHAAALEALQAQMEQELKRLFILAKGALNTH* |
| Ga0070761_101558941 | 3300005591 | Soil | FVIPMPFSRIAIAIGAPYYVPRVTDSAILARLQAEMEQELRRLYGVARAALRAPGRAAG* |
| Ga0066903_1002806181 | 3300005764 | Tropical Forest Soil | APCYVPRVTDATTLGKLQGKMEEELRRLFAVAREALQRRR* |
| Ga0070766_111302171 | 3300005921 | Soil | RVVIAIGPPRYIPRTTAAPGIEALQVEMERELQRLYGVARDALGQR* |
| Ga0079222_114559331 | 3300006755 | Agricultural Soil | IAIGPPRYVPRTTGAGIESLQGEMEQELKRLYGVARDALANS* |
| Ga0066659_102586731 | 3300006797 | Soil | VPRVTDPPSLARLQSQMEQELKRLYGVARAALCRD* |
| Ga0066660_108841902 | 3300006800 | Soil | VPFSRIAIAIGPPFYVPRVTDAALLERLAGEMEGELKRLYGVARAALRAR* |
| Ga0079220_108558541 | 3300006806 | Agricultural Soil | IPVPFLARIAIAVGPPHYVPRVMDAVGLARLEGEMERELHRLFGVARAALAQAR* |
| Ga0105237_103496302 | 3300009545 | Corn Rhizosphere | IPVPFSRVAIAIGPPRYVPRTTAAAGVESLQVAMEQELQRLYGVAKDALEKR* |
| Ga0105085_10439391 | 3300009820 | Groundwater Sand | PRYVPRVTDSASLERMQGELKSELKRLYGVARASLQGHAP* |
| Ga0123355_119771281 | 3300009826 | Termite Gut | IAIGPPFQVPRVTDAATLARLQNQMEAELHRLYGVARDALR* |
| Ga0126310_109361051 | 3300010044 | Serpentine Soil | IAIVIGAPRYVARVTDAAAIEKMQGEMELELKRLFEVARAAL* |
| Ga0126378_104297652 | 3300010361 | Tropical Forest Soil | PVPFARIAIAIGPPCYVPRVTDAASLERLQRQMEAELKRLYEVARAALGTRG* |
| Ga0126381_1009691312 | 3300010376 | Tropical Forest Soil | YVPRVMDATGLERLEGEMERELHRLYGTAREALGGRG* |
| Ga0150983_126957751 | 3300011120 | Forest Soil | IGPPCYVPRVTDAPSLTRLQSQMEQELKRLYGVARAALQPNPGGFC* |
| Ga0137364_102056461 | 3300012198 | Vadose Zone Soil | GPPCYVPRVTDPPSLARLQSQMEQELKRLYGVARGALCRD* |
| Ga0137395_109091762 | 3300012917 | Vadose Zone Soil | VPFSRIAIAIGPPCYVARTTDPATLEALQSQMERELKRLFAEARAALR* |
| Ga0137416_104506952 | 3300012927 | Vadose Zone Soil | VTDAPSLARLQSQMEQELKRLYAVARAALQPHGEGFC* |
| Ga0137407_105582042 | 3300012930 | Vadose Zone Soil | VPFARVALAIGPPRYVPRVTDAAALEALQAQMEQELKRLFTVAKGALNTD* |
| Ga0153915_115387771 | 3300012931 | Freshwater Wetlands | PMPFAKIAIAIGAPRYVPRVTDPAGLESLQAEMESELKRLYETARSALHGKRS* |
| Ga0134110_103193561 | 3300012975 | Grasslands Soil | VPFSRIAIAIGPPFYVPRVTDAALLERLAGEMEGELKRLYAVARAALRAR* |
| Ga0157369_103394451 | 3300013105 | Corn Rhizosphere | FSRVAIAIGPPRYVPRTTAVASVESLQGEMEQELKRLYGVARDALAKR* |
| Ga0132256_1003939832 | 3300015372 | Arabidopsis Rhizosphere | GPPCYVPRVTDAPTLERLQIQMEEELGRLFGVAREALREGG* |
| Ga0182036_104508441 | 3300016270 | Soil | VPRVTDAAMLERLQGQLELELRRLYEVARDALTRRD |
| Ga0182041_115050892 | 3300016294 | Soil | GPPCYVPRVTDAASLERLQGRLEVELKRLYEVAREALVRRT |
| Ga0182035_110895882 | 3300016341 | Soil | VAIAIGPPCYVPRVTDAASLARLQQQMEEELKRLYGVARDALEAP |
| Ga0182037_105136842 | 3300016404 | Soil | GPPCYVPRVTDAASLARLQQQMEEELKRLYGVARDALEAP |
| Ga0182039_113061871 | 3300016422 | Soil | IGPPCYVPRVSDAASLEKLQGKMEEELRRLFAVAREALQRRR |
| Ga0187824_100036853 | 3300017927 | Freshwater Sediment | PFLARIAIAIGPPRYVARVNGAAGLAQLQGEMERELHRVYGVARDALGRQR |
| Ga0187825_101308762 | 3300017930 | Freshwater Sediment | IGPPCYVPRVTDAPTLERLQRRMEEELKRVFGVAQEALRKVR |
| Ga0187785_102608222 | 3300017947 | Tropical Peatland | FVIPVPFSRIAIAVGPPRYVPRVSDRKALERLQAEMELELKRLYLEARAAL |
| Ga0187863_101725061 | 3300018034 | Peatland | PPRYIPRVTDAAVLVAVQAEMEAELKRLFGVARAALGSA |
| Ga0187766_101944351 | 3300018058 | Tropical Peatland | FSRIAIAIGPPCYVPRVTDAATLERLQGQMEQELKRLYGVARAALRGDSVK |
| Ga0187769_100961522 | 3300018086 | Tropical Peatland | VPFSRIAIAIGPPRYVPRVSDAAGLVRLQGQMEEELARLYAVARAALDGKR |
| Ga0179594_101278532 | 3300020170 | Vadose Zone Soil | AIAIGPPRYVPRVTDAPSLTRLQSQMEQELKRLYGVARAALQPDPGGFC |
| Ga0210401_103737571 | 3300020583 | Soil | KFVIPVPFLARIAIAIGPPRYVPRVTDAATLATLQAEMERELQRLYGVAREALR |
| Ga0210401_114522412 | 3300020583 | Soil | IPMPFSRIAIAIGPPCYVPRVTDGATLERLQGRMEEELRRLFEVAREALQARR |
| Ga0210406_103643742 | 3300021168 | Soil | VAIAIGPPRYVPRTSAAAGIEALQVEMEQELKRLYGVAREALGR |
| Ga0210408_100429371 | 3300021178 | Soil | GPPCYVPRVTDPPSLARLQSQMEQELKRLYGVARAALHPNPGRFC |
| Ga0210396_102736712 | 3300021180 | Soil | AWLVKWDKFVIPVPFLARIAIAIGTPRYVARVTDAAGLERLQEEMERELQRLYGVARDVLGERA |
| Ga0210388_107198282 | 3300021181 | Soil | AIGPPRYVPRVTDAATLATLQAQMERELQRLYGVAREALR |
| Ga0210385_110702321 | 3300021402 | Soil | PRSNDGAALEVLQGEMERELKRLYGVARAALAPRT |
| Ga0210387_113225502 | 3300021405 | Soil | PVPFSRVVIAIGPPRYIPRTTAAPGIEALQVEMERELQRLYGVARDALGQR |
| Ga0210384_103938551 | 3300021432 | Soil | RAWLVKWDKFVIPVPFLARIAIAIGTPRYVARVTDAAGLERLQEEMERELQRLYGVARDVLGERA |
| Ga0213878_102889011 | 3300021444 | Bulk Soil | PMPFARIAIAIGPPCYVPRVTDAASLERLQLELEQELGKLFGIAREALQAPR |
| Ga0187846_102699771 | 3300021476 | Biofilm | IGPPRYVSRVTDAAGLARLEEEMEHELHRLYGVARDALAERP |
| Ga0210398_113298122 | 3300021477 | Soil | PRYIPRATAAPGIEALQAEMEQELKRLYGVARDALVRR |
| Ga0126371_110433182 | 3300021560 | Tropical Forest Soil | IAIAIGPPCYVPRVTDAAALQRLQEQMEEELKRLYGVARAALDAPA |
| Ga0224712_105011262 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | RITIAIGPPRYVPRAMDAATLERLQAEMEQELGRVYRLAQSRLRRFERPAEPLE |
| Ga0207671_102914731 | 3300025914 | Corn Rhizosphere | GPPRYVPRTTAAAGVESLQSEMEQELKRLYGVARDALGKR |
| Ga0209235_12799491 | 3300026296 | Grasslands Soil | VVPRVSDASSLARLQSQMEQELKRLYGVARAALHPG |
| Ga0209473_10881582 | 3300026330 | Soil | YVPRVTDPPSLARLQSQMEQELKRLYGVARAALCRD |
| Ga0209158_13422692 | 3300026333 | Soil | PRYVPRVLDAPSLARLQSHMERELKRLYGVARAALHAE |
| Ga0209156_103371391 | 3300026547 | Soil | CYVPRVTDPPSLARLQSQMEQELKRLYGVARAALCRD |
| Ga0209274_102156312 | 3300027853 | Soil | AIGPPVYVPRVIGAAGLEGLQRQMEQELKRLYGVARAAVDLGT |
| Ga0209169_103779861 | 3300027879 | Soil | IPVPFARIALAIGPPVYVPRVVDAAGLERLQRQMEQELKRLYAVARAALST |
| Ga0209168_101492061 | 3300027986 | Surface Soil | LARIAVAVGPPRYVPRVTDAATLQQLQSEMETELKRLYAQARGMLSGTDS |
| Ga0137415_112799842 | 3300028536 | Vadose Zone Soil | AIAIGPPRYVPRTSAAAGIEALQVEMEQELDRLYGVARDALGR |
| Ga0308309_106516991 | 3300028906 | Soil | VIAIGPPRYIPRTTAAPGIEALQVEMEQELQRLYGVARDALGQR |
| Ga0307509_102603431 | 3300031507 | Ectomycorrhiza | GPPVYVPRVMDAASLERKQVELAAELKRLYGVARASLDERAA |
| Ga0318571_104024101 | 3300031549 | Soil | YVPRVTDAATLKQLQAEMEQELRRLYQQARDALGRS |
| Ga0318573_104632362 | 3300031564 | Soil | AIGPACYVPRVTDAASLERLRRQMEEELRRLYGVARGALEMHR |
| Ga0318542_101536962 | 3300031668 | Soil | YVPRVTDAAGLARLQEQMEEELKRLFGVAREALRAAR |
| Ga0310686_1141455682 | 3300031708 | Soil | ARIAIAIGPPFYVPRVTDATTLARLQTQMEEELLRLYRVARAALGTV |
| Ga0307476_100627182 | 3300031715 | Hardwood Forest Soil | FVIPMPFARIAIAIGPPCYVPRVTDAASLARLQGQMEEELRRLFGVAHEALRAAR |
| Ga0307469_112389951 | 3300031720 | Hardwood Forest Soil | PRVTDAASLTRLQSQMEQELKRLYGVARAALHPNPGGFC |
| Ga0307469_123670442 | 3300031720 | Hardwood Forest Soil | RIAIAIGEPRYVPRVTDAAALERMQGEMEAELRRLFGVARAALES |
| Ga0307468_1012111931 | 3300031740 | Hardwood Forest Soil | AIAIGAPVYVPRVTDAASLERLQGQMEGTLKGLFGVARAALSGG |
| Ga0307468_1024238131 | 3300031740 | Hardwood Forest Soil | PPYYVPRVTDAASLERLQRHMEGELQRLYGVARAALSPAARVAG |
| Ga0306918_104078181 | 3300031744 | Soil | ARIAIAIGPPCYVPRVTDAASLERLQGQLEVELKRLYEVARQALVRRT |
| Ga0307477_108938822 | 3300031753 | Hardwood Forest Soil | FVIPMPFSRIAIAIGPACYVPRVTDAPSLARLQSQMEQELKRLYGVARAALHPNPGAFC |
| Ga0318498_104559652 | 3300031778 | Soil | VIPIPFSRIALAIGPPCYVPRVTDAAMLERLQGQMEQELRRLYGVARDALARRD |
| Ga0318552_101545792 | 3300031782 | Soil | VPRVTDAASLERLQGRLEVELKRLYEVAREALVRRT |
| Ga0318529_100658391 | 3300031792 | Soil | PMPFSRIALAIGPPCYVPRVTDAALLERLQGQMEQELRRLYGVARDALVRRG |
| Ga0318503_102530011 | 3300031794 | Soil | PCYVPRVTDAAGLARLQEQMEEELKRLFGVAREALRAAR |
| Ga0318568_106900231 | 3300031819 | Soil | CYVPRVTDAASLERLQGRMEEELKRLYAVARAALEAHR |
| Ga0307478_103221191 | 3300031823 | Hardwood Forest Soil | PPRYVPRATGAAALTQLQGQMQEELKRLYGVARAAL |
| Ga0318564_104605692 | 3300031831 | Soil | FARIAIAIGAPCYVPRVTDAAAIERLQGQMEADLKRLYEVAREALERRG |
| Ga0318564_105179881 | 3300031831 | Soil | IGPACYVPRVTDAASLERLRRQMEEELRRLYGVARGALEMHR |
| Ga0318499_101294582 | 3300031832 | Soil | IGPPCYVPRVTDAALLERLQGQMEQELRRLYGVARDALVRRG |
| Ga0318517_101229952 | 3300031835 | Soil | GPPCYVPRVTDAASLERLQGRMEEELKRLYAVARAALEAHR |
| Ga0310916_105513771 | 3300031942 | Soil | AIGPPCYVPRVTDAASLERLQGRLEVELKRLYEVAREALVRRT |
| Ga0310913_100514441 | 3300031945 | Soil | YVPRVTDAATLERLQRQMEEELRRLYGVAREALERHR |
| Ga0306922_123381091 | 3300032001 | Soil | GPPCYVPRVTDAAALAGLQSQLELELQRLFAVARAALGPR |
| Ga0318562_104399521 | 3300032008 | Soil | PCYVPRVSDAASLEKLQGKMEEELRRLFAVAREALQRRR |
| Ga0310911_108163532 | 3300032035 | Soil | VIPMPFSRIAIAIGPPCYVPRVSDAASLEKLQGKMEEELRRLFAVAREALQRRR |
| Ga0318558_102691271 | 3300032044 | Soil | FYVPRVTDTALLERLQDQMAEELRKLFGVAREALQKAR |
| Ga0318532_102862772 | 3300032051 | Soil | YVPRVTDAASLERLQGRLEVELKRLYEVAREALVRRT |
| Ga0318553_100074215 | 3300032068 | Soil | SRIALAIGPPCYVPRVTDAALLERLQGQMEQELRRLYGVARDALVRRG |
| Ga0307471_1004340912 | 3300032180 | Hardwood Forest Soil | PVPFSSIAIAIGPACYVPRVTDAAALARLQLKMEGELKRLYGVAREALRAR |
| Ga0307471_1010468262 | 3300032180 | Hardwood Forest Soil | IPMPFSRIAIAIGPPCYVPRVTDAPTLTRLQSQMEQELKRLYGVARAALQPSPGAFC |
| Ga0318519_106752041 | 3300033290 | Soil | FARVAIAIGPPCYVPRVTDAASLARLQQQMEEELKRLYGVARDALEAP |
| Ga0314866_033435_1_138 | 3300033807 | Peatland | RIAIAIGPPCYVPRVTDGATLERLQGEMEQELKRLFGVARDALRG |
| ⦗Top⦘ |