


| Basic Information | |
|---|---|
| Family ID | F097076 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VDGVDALHRRLSRVPPGSTLTLRVVRRTQLVDVALTVREPP |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.88 % |
| % of genes near scaffold ends (potentially truncated) | 98.08 % |
| % of genes from short scaffolds (< 2000 bps) | 91.35 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.692 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.731 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.654 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.885 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.94% β-sheet: 23.19% Coil/Unstructured: 60.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF13302 | Acetyltransf_3 | 30.77 |
| PF00310 | GATase_2 | 17.31 |
| PF00398 | RrnaAD | 2.88 |
| PF13376 | OmdA | 2.88 |
| PF05960 | DUF885 | 1.92 |
| PF04898 | Glu_syn_central | 1.92 |
| PF12840 | HTH_20 | 1.92 |
| PF01402 | RHH_1 | 0.96 |
| PF05643 | DUF799 | 0.96 |
| PF04134 | DCC1-like | 0.96 |
| PF00149 | Metallophos | 0.96 |
| PF02452 | PemK_toxin | 0.96 |
| PF13365 | Trypsin_2 | 0.96 |
| PF01850 | PIN | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 2.88 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 1.92 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.96 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.96 |
| COG4380 | Uncharacterized conserved protein, DUF799 domain | Function unknown [S] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.69 % |
| Unclassified | root | N/A | 17.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101689812 | Not Available | 2255 | Open in IMG/M |
| 3300000789|JGI1027J11758_12265936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 571 | Open in IMG/M |
| 3300004633|Ga0066395_10564977 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
| 3300005171|Ga0066677_10028923 | All Organisms → cellular organisms → Bacteria | 2636 | Open in IMG/M |
| 3300005187|Ga0066675_11272115 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300005450|Ga0066682_10467462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 800 | Open in IMG/M |
| 3300005556|Ga0066707_10962108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 521 | Open in IMG/M |
| 3300005560|Ga0066670_10839499 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005561|Ga0066699_10797749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
| 3300005569|Ga0066705_10741405 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005712|Ga0070764_11091934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300006032|Ga0066696_11063872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300006057|Ga0075026_100634469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300006755|Ga0079222_11513693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300006797|Ga0066659_10643992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 863 | Open in IMG/M |
| 3300006954|Ga0079219_10922954 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300010048|Ga0126373_12723348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
| 3300010321|Ga0134067_10094718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1015 | Open in IMG/M |
| 3300010321|Ga0134067_10499012 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300010358|Ga0126370_10912245 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
| 3300010358|Ga0126370_11099512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
| 3300010376|Ga0126381_101197652 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300010376|Ga0126381_101792615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 886 | Open in IMG/M |
| 3300011120|Ga0150983_15565027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300012202|Ga0137363_10936211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
| 3300012361|Ga0137360_10260402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1428 | Open in IMG/M |
| 3300012362|Ga0137361_11416292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300012927|Ga0137416_11738625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 569 | Open in IMG/M |
| 3300012927|Ga0137416_12228683 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300012960|Ga0164301_10179571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1328 | Open in IMG/M |
| 3300014201|Ga0181537_10421741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 915 | Open in IMG/M |
| 3300015054|Ga0137420_1341319 | Not Available | 1302 | Open in IMG/M |
| 3300015359|Ga0134085_10397370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300016294|Ga0182041_10159643 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
| 3300016319|Ga0182033_11277073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 659 | Open in IMG/M |
| 3300016404|Ga0182037_10408095 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300017936|Ga0187821_10382653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300017970|Ga0187783_11292414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 526 | Open in IMG/M |
| 3300018058|Ga0187766_10900836 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300018433|Ga0066667_10080239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2099 | Open in IMG/M |
| 3300018482|Ga0066669_10186255 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300020580|Ga0210403_10068836 | All Organisms → cellular organisms → Bacteria | 2843 | Open in IMG/M |
| 3300020582|Ga0210395_10445801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 974 | Open in IMG/M |
| 3300020583|Ga0210401_11543340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300021171|Ga0210405_10746486 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300021384|Ga0213876_10476476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 664 | Open in IMG/M |
| 3300021420|Ga0210394_10795063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 826 | Open in IMG/M |
| 3300021432|Ga0210384_10558432 | Not Available | 1029 | Open in IMG/M |
| 3300021477|Ga0210398_10723732 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
| 3300021477|Ga0210398_11535111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300021560|Ga0126371_10563498 | Not Available | 1288 | Open in IMG/M |
| 3300026067|Ga0207678_11388005 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300026314|Ga0209268_1057172 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300026550|Ga0209474_10190392 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300026555|Ga0179593_1095018 | Not Available | 3035 | Open in IMG/M |
| 3300026557|Ga0179587_10165613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1384 | Open in IMG/M |
| 3300027879|Ga0209169_10265331 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 900 | Open in IMG/M |
| 3300027965|Ga0209062_1203093 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
| 3300028381|Ga0268264_10953581 | Not Available | 863 | Open in IMG/M |
| 3300028792|Ga0307504_10055837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1143 | Open in IMG/M |
| 3300028906|Ga0308309_10754886 | Not Available | 845 | Open in IMG/M |
| 3300030730|Ga0307482_1270262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300030862|Ga0265753_1090795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 605 | Open in IMG/M |
| 3300031057|Ga0170834_103448265 | Not Available | 659 | Open in IMG/M |
| 3300031231|Ga0170824_119551274 | Not Available | 857 | Open in IMG/M |
| 3300031474|Ga0170818_105793529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 976 | Open in IMG/M |
| 3300031543|Ga0318516_10003146 | All Organisms → cellular organisms → Bacteria | 7032 | Open in IMG/M |
| 3300031546|Ga0318538_10521745 | Not Available | 644 | Open in IMG/M |
| 3300031572|Ga0318515_10155068 | Not Available | 1222 | Open in IMG/M |
| 3300031573|Ga0310915_10232771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1294 | Open in IMG/M |
| 3300031708|Ga0310686_103261742 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300031715|Ga0307476_10602881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 814 | Open in IMG/M |
| 3300031719|Ga0306917_11468358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300031764|Ga0318535_10049019 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
| 3300031764|Ga0318535_10403346 | Not Available | 610 | Open in IMG/M |
| 3300031777|Ga0318543_10332603 | Not Available | 680 | Open in IMG/M |
| 3300031793|Ga0318548_10263246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
| 3300031794|Ga0318503_10152787 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300031796|Ga0318576_10008011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3766 | Open in IMG/M |
| 3300031798|Ga0318523_10095653 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300031819|Ga0318568_10563579 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300031831|Ga0318564_10463493 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300031832|Ga0318499_10040407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1717 | Open in IMG/M |
| 3300031859|Ga0318527_10139097 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300031860|Ga0318495_10480808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
| 3300031879|Ga0306919_10573919 | Not Available | 870 | Open in IMG/M |
| 3300031894|Ga0318522_10188395 | Not Available | 780 | Open in IMG/M |
| 3300031912|Ga0306921_10437822 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
| 3300031941|Ga0310912_10146648 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
| 3300031959|Ga0318530_10070511 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300031981|Ga0318531_10254262 | Not Available | 793 | Open in IMG/M |
| 3300032008|Ga0318562_10355108 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 852 | Open in IMG/M |
| 3300032008|Ga0318562_10355549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 852 | Open in IMG/M |
| 3300032054|Ga0318570_10293100 | Not Available | 739 | Open in IMG/M |
| 3300032063|Ga0318504_10132819 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300032091|Ga0318577_10426690 | Not Available | 633 | Open in IMG/M |
| 3300032261|Ga0306920_101993124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 813 | Open in IMG/M |
| 3300032261|Ga0306920_103415760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
| 3300032261|Ga0306920_104052912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300032261|Ga0306920_104231230 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300032783|Ga0335079_10000741 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 37246 | Open in IMG/M |
| 3300032892|Ga0335081_11626749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 708 | Open in IMG/M |
| 3300033158|Ga0335077_10109374 | All Organisms → cellular organisms → Bacteria | 3230 | Open in IMG/M |
| 3300033807|Ga0314866_016206 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.88% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.92% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027965 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1016898124 | 3300000364 | Soil | AVNREPVDGIDTLHRLLGRVPPGSELTLQVVRRTQLVDVGLTVREPPA* |
| JGI1027J11758_122659362 | 3300000789 | Soil | DALHRLLSRVPPGSELTLQLVRRTQLVEVGLVVREPPT* |
| Ga0066395_105649772 | 3300004633 | Tropical Forest Soil | DLIVRVNDTDVDSIDSLHRQLARVSPDTALTLHIVRRTQLHAIALTVREPTA* |
| Ga0066677_100289234 | 3300005171 | Soil | LIVAVDDSYVDGVDALHRRLSRVPPGSTLTLRVVRRTQLVSVALTVREPP* |
| Ga0066675_112721152 | 3300005187 | Soil | AVDDSYVDGVDALHRRLSRVPPGSTLTLQVVRRTQLVSIALTVREPP* |
| Ga0066682_104674621 | 3300005450 | Soil | VDGVDALHRRLSRVPPGSTLTLRVVRRTQLVDVALTVREPP* |
| Ga0066707_109621082 | 3300005556 | Soil | AVNDEPVDGIDALHRRLSRVPPGTTLTLKVVRRTHLVDIALAVREPP* |
| Ga0066670_108394991 | 3300005560 | Soil | DEPVDGIDALHRRLSRVPPGTTLTLKVVRRTHLVDIALAVREPP* |
| Ga0066699_107977491 | 3300005561 | Soil | ALHRRLSRVPPGTTLTLKVVRRTHLVDIALAVREPP* |
| Ga0066705_107414051 | 3300005569 | Soil | AVDDQPVDGVDALHRRLSRVAPGSTLNLQVVRRTQRVNIALTVREPP* |
| Ga0070764_110919341 | 3300005712 | Soil | HRHLSRVAPGAALQLQVVRRTQLREITLTAREPP* |
| Ga0066696_110638722 | 3300006032 | Soil | GIDALHRRLSRVPPGTTLTLKVVRRTHLVDIALAVREPP* |
| Ga0075026_1006344691 | 3300006057 | Watersheds | PVDGVDALHRRLSRVPPGSALTLQVVRRTQLVNIALTVREPP* |
| Ga0079222_115136932 | 3300006755 | Agricultural Soil | DEPVDGIDTLHRLLGGVPPGTGLALTVVRRTRRLTVPLTAREPAG* |
| Ga0066659_106439921 | 3300006797 | Soil | DALHRRLSRVPPGTTLTLKVVRRTHLVDIALAVREPP* |
| Ga0079219_109229543 | 3300006954 | Agricultural Soil | LIVGVGAQVVDGIDALHRLLGRVPPGTTLELGIVRRTQLLTVPLTTREPP* |
| Ga0126373_127233482 | 3300010048 | Tropical Forest Soil | REPVEGIDALHRLLSRVPPGSELTLQVVRRTQLLTVGLIVREPP* |
| Ga0134067_100947181 | 3300010321 | Grasslands Soil | IDALHRRLSRVPPGTTLTLKVVRRTHLVDIALAVREPP* |
| Ga0134067_104990121 | 3300010321 | Grasslands Soil | HRRLSRVPPGTTLTLKVVRRTHLVDIALAVREPP* |
| Ga0126370_109122452 | 3300010358 | Tropical Forest Soil | VAVNREPVDGIDALHRLLSRVPPGSELTLQVVRRTQLLNVGLIVREPS* |
| Ga0126370_110995123 | 3300010358 | Tropical Forest Soil | VDGIDSLHRQLARIPPDSTLTLHIVRRTQLRAIALTVREPPA* |
| Ga0126381_1011976523 | 3300010376 | Tropical Forest Soil | QAVDGIDALHRALSRVPPGSALELTIVRRTERLTVALTAREPP* |
| Ga0126381_1017926151 | 3300010376 | Tropical Forest Soil | IVRVNDTDVDGIDSLHRQLARVTPDTTLTLHIVRRTQLHAIALTVREPTA* |
| Ga0150983_155650271 | 3300011120 | Forest Soil | EAVDGIDALHRQLARVPPGTGLTLKVVRRTRLLDLPLTVREPGR* |
| Ga0137363_109362111 | 3300012202 | Vadose Zone Soil | DGVDALHRRLSRVAPGSTLNLQVVRRTQRVNIALTVREPP* |
| Ga0137360_102604021 | 3300012361 | Vadose Zone Soil | HRRLSRVPPGSALTLQVVRRTQRVNIALTVREPP* |
| Ga0137361_114162922 | 3300012362 | Vadose Zone Soil | IVAVDDQPVDGVDALHRRLSRVPPGSTLNLQVVRRTQRVNIALTVREPP* |
| Ga0137416_117386252 | 3300012927 | Vadose Zone Soil | VDALHRRLSRVPPGSALTLQVVRRTQRVNIALTVREPP* |
| Ga0137416_122286831 | 3300012927 | Vadose Zone Soil | GVDALHRRLSRVPPGSALTLQVVRRTQRVNIALTVREPP* |
| Ga0164301_101795713 | 3300012960 | Soil | GVGGQVVDGIDALHRLLGRVPPGTTLELGIVRRTQLLTVPLTTREPP* |
| Ga0181537_104217411 | 3300014201 | Bog | QRLARVPPGSELTLGVVRRVQRLSVTLTAREPPP* |
| Ga0137420_13413194 | 3300015054 | Vadose Zone Soil | VAVDDQPVDGVDALHRRLSRVAPGSTLNLQVVRRTQRVNIALTVREPP* |
| Ga0134085_103973702 | 3300015359 | Grasslands Soil | VAVDDSYVDGVDALHRRLSRVPPGSTLTLQVVRRTQLVNVALTVREPP* |
| Ga0182041_101596433 | 3300016294 | Soil | DLIVAVNEEPVDGIDALHRLLSRVPPGSELTLQVVRRTQRLEVGLIVREPPA |
| Ga0182033_112770732 | 3300016319 | Soil | LRAGDLIVGVDDQSVDGIDALHRAMGPIAPGVQLRLAIVRRTQRLVLELTAREPPAE |
| Ga0182037_104080953 | 3300016404 | Soil | EEPVDGIDALHRLLSRVPPGSELTLQVVRRTQRLEVGLIVREPPA |
| Ga0187821_103826531 | 3300017936 | Freshwater Sediment | GDLIVAVNGESVDGIDALHRQLARVPPGTGLTLKVVRRTRLLELPLTVREPGG |
| Ga0187783_112924141 | 3300017970 | Tropical Peatland | QSVDGIDALHRALSRVAPGAALELAIVRRTQRLTLEVIAREPP |
| Ga0187766_109008362 | 3300018058 | Tropical Peatland | ETDVDGIDALHRQLARVPPDTTLTLHVVRRTQLRAVELRVREPLA |
| Ga0066667_100802394 | 3300018433 | Grasslands Soil | GVDALHRRLSRVPPGSTLTLQVVRRTQLVSIALTVREPP |
| Ga0066669_101862555 | 3300018482 | Grasslands Soil | GVDALHRRLSRVPPGSTLTLQVVRRTQLVNVALTVREPP |
| Ga0210403_100688361 | 3300020580 | Soil | ALHRLLSRVPPGSELTLQVVRRTQLLDVGLIVREPPT |
| Ga0210395_104458013 | 3300020582 | Soil | DALHRQLARVPPGTGLTLKVVRRTRLLDLPLTVREPGR |
| Ga0210401_115433402 | 3300020583 | Soil | VDALHRQLARVPPGSRLTLGIVRRMRLLDVPLTAREPPG |
| Ga0210405_107464863 | 3300021171 | Soil | PVDGVDALHRRLSRVPPGSALTLQVVRRTQRVNIALTVREPP |
| Ga0213876_104764762 | 3300021384 | Plant Roots | VNGESVDGIDALHRRLSRVPLGSELALQVVRRTQLLPVTLTVCEPPG |
| Ga0210394_107950631 | 3300021420 | Soil | AVDDQPVDGVDALHRRLSRVPPGSALTLQVVRRTQRVNIALTVREPP |
| Ga0210384_105584321 | 3300021432 | Soil | GVDALHRALGRVPPGTQLQLQIVRRTQLLTVSLTAREPP |
| Ga0210398_107237323 | 3300021477 | Soil | LHRELARVPPGSRLTLKVVRRTELLEIPLTVREPAAAS |
| Ga0210398_115351112 | 3300021477 | Soil | IVAVDGEALDGIDALHRYLSRVAPGTALQLKVVRRTQLLAIPLTVREPPA |
| Ga0126371_105634981 | 3300021560 | Tropical Forest Soil | GIDSLHRQLARVPPDSTLTLHIVRRTQLRAIELTVREPPA |
| Ga0207678_113880051 | 3300026067 | Corn Rhizosphere | VVDGIDTLHRLLGRVPPGSELVLDIVRRTQRLTVALTAREPPS |
| Ga0209268_10571723 | 3300026314 | Soil | DGIDALHRRLSRVPPGTTLTLKVVRRTHLVDIALAVREPP |
| Ga0209474_101903923 | 3300026550 | Soil | VDGIDALHRRLSRVPPGTTLTLKVVRRTHLVDIALAVREPP |
| Ga0179593_10950184 | 3300026555 | Vadose Zone Soil | VAVDDQPVDGVDALHRRLSRVAPGSTLNLQVVRRTQRVNIALT |
| Ga0179587_101656131 | 3300026557 | Vadose Zone Soil | PVDGVDALHRRLSRVAPGSTLNLQVVRRTQRVNIALTVREPP |
| Ga0209169_102653313 | 3300027879 | Soil | GDLIVAVDGEALDGIDALHRYLSRVVPGTALQLKVVRRTQLLAVPLTVREPPA |
| Ga0209062_12030932 | 3300027965 | Surface Soil | IVAVNGTAVDGIDTLHRLLGRVAPGSELALGIVRRTQRLTISVTAREPPG |
| Ga0268264_109535811 | 3300028381 | Switchgrass Rhizosphere | VDGIDTLHRLLGRVPPGSELVLDIVRRTQRLAVALTAREPPS |
| Ga0307504_100558372 | 3300028792 | Soil | VDALHRRLSRVPPGSALTLQVVRRTQRVNIALTVREPP |
| Ga0308309_107548861 | 3300028906 | Soil | GEAVDGIDTLHQRLARVPPGSELTLGVVRRTQRLNVALVAREPEG |
| Ga0307482_12702622 | 3300030730 | Hardwood Forest Soil | GSVDGIDALHRQLARVPPGARLTLGVVRRTRLLDVPLTAREPP |
| Ga0265753_10907953 | 3300030862 | Soil | GVDALHRALGRVPPGTDLELQIVRRTQRFTVSLTAREPP |
| Ga0170834_1034482652 | 3300031057 | Forest Soil | TVNREPVDGIDALHRLLSRVPPGSELTLQVVRRTQLLDVGLIVREPPP |
| Ga0170824_1195512741 | 3300031231 | Forest Soil | LIVTVNREPVDGIDALHRLLSRVPPGSELTLQVVRRTQLLDVGLIVREPPP |
| Ga0170818_1057935292 | 3300031474 | Forest Soil | NGESVDGIDTLHRLLGRVPPGSELTLELVRRTQRLIVTLIAREPPPE |
| Ga0318516_100031465 | 3300031543 | Soil | ALHRQLARVPPDTTLTLHIVRRTQLRAIALTVREPPA |
| Ga0318538_105217452 | 3300031546 | Soil | ALHRLLSRVPPGSELKLQVVRRTQRVEVGLIVREPPS |
| Ga0318515_101550682 | 3300031572 | Soil | LIVRVNDADVDGIDSLHRQLARVPPDDTLTLHIVRRTQLRVVELTVREPPA |
| Ga0310915_102327711 | 3300031573 | Soil | IDALHRQLARVPPDTTLTLHIVRRTQLRAIALTVREPPA |
| Ga0310686_1032617424 | 3300031708 | Soil | VNGQSVDGIDALHRALGRVAPGTQLQLSIVRRTQLIAVSLTAREPPL |
| Ga0307476_106028811 | 3300031715 | Hardwood Forest Soil | DLIVAVDGEALDGIDALHRYLSRVAPGTALQLKVVRRTQLLAVPLTVREPPA |
| Ga0306917_114683581 | 3300031719 | Soil | ADVEGIDALHRQLARVPPDTTLTLQIVRRTQLRTIALTVREPPA |
| Ga0318535_100490191 | 3300031764 | Soil | RSGDLIVRINDADVDGIDALHRRLARIPPDTTLTLHIVRRTQLRAITLTAREPPG |
| Ga0318535_104033461 | 3300031764 | Soil | PGDLIVAVNREPVDGIDALHRLLSRVPPGSELTLQVVRRTQLLDVGLIVREPPG |
| Ga0318543_103326031 | 3300031777 | Soil | NREAVDGIDALHRLLSRVPPGSELKLQVVRRTQLVEVGLIVREPPS |
| Ga0318548_102632461 | 3300031793 | Soil | LRSGDLIVRVNDADVEGIDALHRQLACVPPDTTLTLHIVRRTQLRAIALTVREPPA |
| Ga0318503_101527872 | 3300031794 | Soil | RSGDLLVGVDDEEVDGIDALHRRLSRVPPGTVLTLRIVRRTQRLELPLTAREPPP |
| Ga0318576_100080111 | 3300031796 | Soil | ADVEGIDALHRQLARVPPDTTLTLHIVRRTQLRAIALTVREPPA |
| Ga0318523_100956531 | 3300031798 | Soil | IDALHRRLARIPTDTTLTLHIVRRTQLRAITLTAREPPG |
| Ga0318568_105635792 | 3300031819 | Soil | EEVDGIDALHRRLSRVPPGTVLTLRIVRRTQRLELPLTAREPPP |
| Ga0318564_104634932 | 3300031831 | Soil | IVAVNEEPVDGIDALHRLLGRVPPGSELTLQVVRRTQLVEVGLVVREPPP |
| Ga0318499_100404074 | 3300031832 | Soil | VNDADVDGIDALHRQLARVPPDTTLTLQVVRRTQLLTIAFTAREPPA |
| Ga0318527_101390973 | 3300031859 | Soil | VDGIDALHRRLSRVPPGTVLTLRIVRRTQRLELPLTAREPPP |
| Ga0318495_104808082 | 3300031860 | Soil | DLIVAVNREPVDGIDALHRLLSRVPPGSELTLQVVRRTQLLDVGLIVREPPG |
| Ga0306919_105739191 | 3300031879 | Soil | DVDGIDALHRRLACIPPDTTLTLHIVRRTQLRAITLTAREPPG |
| Ga0318522_101883952 | 3300031894 | Soil | LHRLLSRVPPGSELTLQVVRRTQRLEVGLIVREPPA |
| Ga0306921_104378221 | 3300031912 | Soil | VNGTPVDGIDALHRLLSRVPPGSELTLQVVRRTQQLEVALSVREPPA |
| Ga0310912_101466483 | 3300031941 | Soil | IDALHRLLSRVPPGSELTLQVVRRTQRLEVGLIVREPPA |
| Ga0318530_100705111 | 3300031959 | Soil | ALHRLLGRVPPGSELTLQVVRRTQLVEVGLVVREPPP |
| Ga0318531_102542621 | 3300031981 | Soil | RVNDADVDGIDALHRQLARVPPDSTLTLHIVRRTQLRTIALTVREPPS |
| Ga0318562_103551083 | 3300032008 | Soil | MIVAVNEQPVDGIDALHRQLSRVPPGSDLRLTVVRRTEQLTLSMTAREPP |
| Ga0318562_103555493 | 3300032008 | Soil | ADVDGIDALHRQLARVPPDTTLTLQVVRRTQLLTIAFTAREPPA |
| Ga0318570_102931001 | 3300032054 | Soil | PGDLIVAVNEEPVDGIDALHRLLGRVPPGSELTLQVVRRTQLVEVGLVVREPPP |
| Ga0318504_101328191 | 3300032063 | Soil | VNEEPVDGIDALHRLLGRVPPGSELTLQVVRRTQLVEVGLVVREPPP |
| Ga0318577_104266902 | 3300032091 | Soil | ALHRQLARVPPDSTLTLHIVRRTQLRTIALTVREPPS |
| Ga0306920_1019931242 | 3300032261 | Soil | EAVDGIDALHRLLSRVPPGSELKLQVVRRTQLVEVGLIVREPPS |
| Ga0306920_1034157601 | 3300032261 | Soil | VNDADVEGIDALHRQLARVPPDTTLTLQIVRRTQLRTIALTVREPPA |
| Ga0306920_1040529121 | 3300032261 | Soil | QVIDGIDALHRQLARVPPGSALRLKIVRRTQLLDVSLTAREPPG |
| Ga0306920_1042312301 | 3300032261 | Soil | AVDGIDALHRALSRVPPGSTLELTIVRRTERLTVALTAREPP |
| Ga0335079_100007411 | 3300032783 | Soil | LHRRLARVPPGTELTLSVVRRTRLLKVPLTGREPSR |
| Ga0335081_116267491 | 3300032892 | Soil | RLLGRVPPGSELTLELVRRTQRLSITLTVREPQPP |
| Ga0335077_101093743 | 3300033158 | Soil | VGGIDELHRLLSRVPPGNELTLRVVRRTQLLDVRLIAREPPGS |
| Ga0314866_016206_916_1050 | 3300033807 | Peatland | VAVGGIDALHRRLARVPPGTELTLSVVRRTRLLKVPVTGREPPG |
| ⦗Top⦘ |