


| Basic Information | |
|---|---|
| Family ID | F097050 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSRVIAVTACGFMLAACSATMPSLSLDFMKSAPQAETLAIE |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.12 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.31 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.731 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.577 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.808 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 49.28% β-sheet: 0.00% Coil/Unstructured: 50.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF13419 | HAD_2 | 16.35 |
| PF13242 | Hydrolase_like | 8.65 |
| PF12146 | Hydrolase_4 | 2.88 |
| PF00196 | GerE | 1.92 |
| PF04392 | ABC_sub_bind | 1.92 |
| PF01274 | Malate_synthase | 1.92 |
| PF01593 | Amino_oxidase | 0.96 |
| PF00756 | Esterase | 0.96 |
| PF07007 | LprI | 0.96 |
| PF01520 | Amidase_3 | 0.96 |
| PF08281 | Sigma70_r4_2 | 0.96 |
| PF04343 | DUF488 | 0.96 |
| PF01464 | SLT | 0.96 |
| PF00144 | Beta-lactamase | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG2225 | Malate synthase | Energy production and conversion [C] | 1.92 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.92 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.96 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.96 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.96 |
| COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.50 % |
| Unclassified | root | N/A | 12.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000655|AF_2010_repII_A100DRAFT_1102177 | Not Available | 502 | Open in IMG/M |
| 3300005363|Ga0008090_15720273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 848 | Open in IMG/M |
| 3300005518|Ga0070699_100379912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1275 | Open in IMG/M |
| 3300005536|Ga0070697_100066945 | Not Available | 2937 | Open in IMG/M |
| 3300005713|Ga0066905_101918086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
| 3300005764|Ga0066903_101785600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1174 | Open in IMG/M |
| 3300005764|Ga0066903_106795408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 594 | Open in IMG/M |
| 3300005764|Ga0066903_106966121 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300006791|Ga0066653_10274654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 856 | Open in IMG/M |
| 3300009162|Ga0075423_12951262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300010043|Ga0126380_11036875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
| 3300010046|Ga0126384_11931271 | Not Available | 563 | Open in IMG/M |
| 3300010048|Ga0126373_12558417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300010358|Ga0126370_10313632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1250 | Open in IMG/M |
| 3300010358|Ga0126370_10919092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 792 | Open in IMG/M |
| 3300010360|Ga0126372_10353822 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1319 | Open in IMG/M |
| 3300010366|Ga0126379_12712718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 592 | Open in IMG/M |
| 3300010398|Ga0126383_10947186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
| 3300012210|Ga0137378_10584431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1026 | Open in IMG/M |
| 3300012938|Ga0162651_100054607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300012948|Ga0126375_11347143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300012958|Ga0164299_10334312 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
| 3300012977|Ga0134087_10776076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300014166|Ga0134079_10429827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 621 | Open in IMG/M |
| 3300015372|Ga0132256_103095100 | Not Available | 559 | Open in IMG/M |
| 3300015374|Ga0132255_103819839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. 131-2-1 | 640 | Open in IMG/M |
| 3300016270|Ga0182036_11217729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 626 | Open in IMG/M |
| 3300016319|Ga0182033_10093217 | All Organisms → cellular organisms → Bacteria | 2195 | Open in IMG/M |
| 3300016319|Ga0182033_10303437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1318 | Open in IMG/M |
| 3300016319|Ga0182033_11606821 | Not Available | 588 | Open in IMG/M |
| 3300016319|Ga0182033_12005240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300016357|Ga0182032_11099051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 682 | Open in IMG/M |
| 3300016357|Ga0182032_11170930 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
| 3300016371|Ga0182034_10176740 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300016371|Ga0182034_10789418 | Not Available | 812 | Open in IMG/M |
| 3300016387|Ga0182040_10310531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1209 | Open in IMG/M |
| 3300016387|Ga0182040_11245813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
| 3300016404|Ga0182037_10460621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1059 | Open in IMG/M |
| 3300016422|Ga0182039_10860128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 808 | Open in IMG/M |
| 3300016422|Ga0182039_10880992 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 798 | Open in IMG/M |
| 3300016445|Ga0182038_10107902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2040 | Open in IMG/M |
| 3300018482|Ga0066669_11330029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
| 3300021372|Ga0213877_10192584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300021439|Ga0213879_10007700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2228 | Open in IMG/M |
| 3300021476|Ga0187846_10449567 | Not Available | 528 | Open in IMG/M |
| 3300021478|Ga0210402_10043259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3921 | Open in IMG/M |
| 3300025906|Ga0207699_10230807 | Not Available | 1267 | Open in IMG/M |
| 3300025910|Ga0207684_11724741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300026326|Ga0209801_1180754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 866 | Open in IMG/M |
| 3300026557|Ga0179587_10520635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 781 | Open in IMG/M |
| 3300027654|Ga0209799_1054137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 898 | Open in IMG/M |
| 3300028536|Ga0137415_11121693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300028710|Ga0307322_10170097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300028721|Ga0307315_10082521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 929 | Open in IMG/M |
| 3300028810|Ga0307294_10066372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1081 | Open in IMG/M |
| 3300031170|Ga0307498_10037581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1237 | Open in IMG/M |
| 3300031545|Ga0318541_10241900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1002 | Open in IMG/M |
| 3300031545|Ga0318541_10613303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300031561|Ga0318528_10105358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1482 | Open in IMG/M |
| 3300031573|Ga0310915_11189457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300031679|Ga0318561_10189838 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300031680|Ga0318574_10027628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2837 | Open in IMG/M |
| 3300031682|Ga0318560_10656372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300031713|Ga0318496_10437537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 723 | Open in IMG/M |
| 3300031719|Ga0306917_10339757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1165 | Open in IMG/M |
| 3300031719|Ga0306917_10471338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 984 | Open in IMG/M |
| 3300031719|Ga0306917_10860027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300031719|Ga0306917_11147210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
| 3300031719|Ga0306917_11301113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
| 3300031770|Ga0318521_10655817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300031771|Ga0318546_10536822 | Not Available | 821 | Open in IMG/M |
| 3300031771|Ga0318546_10715750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300031771|Ga0318546_10813782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300031781|Ga0318547_10360054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 889 | Open in IMG/M |
| 3300031794|Ga0318503_10213194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 626 | Open in IMG/M |
| 3300031796|Ga0318576_10146554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1099 | Open in IMG/M |
| 3300031846|Ga0318512_10112764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1287 | Open in IMG/M |
| 3300031879|Ga0306919_10106447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1983 | Open in IMG/M |
| 3300031879|Ga0306919_10954124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300031879|Ga0306919_11069997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 615 | Open in IMG/M |
| 3300031890|Ga0306925_10079576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3462 | Open in IMG/M |
| 3300031890|Ga0306925_12116696 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300031893|Ga0318536_10619449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
| 3300031896|Ga0318551_10776914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300031897|Ga0318520_11016537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300031910|Ga0306923_10470212 | Not Available | 1424 | Open in IMG/M |
| 3300031910|Ga0306923_10940746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 943 | Open in IMG/M |
| 3300031941|Ga0310912_10166263 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300031941|Ga0310912_11476214 | Not Available | 512 | Open in IMG/M |
| 3300031945|Ga0310913_10937361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300031945|Ga0310913_11085635 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300032001|Ga0306922_10400939 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300032001|Ga0306922_11783828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300032001|Ga0306922_12194970 | Not Available | 532 | Open in IMG/M |
| 3300032010|Ga0318569_10192689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 943 | Open in IMG/M |
| 3300032039|Ga0318559_10128304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1141 | Open in IMG/M |
| 3300032044|Ga0318558_10555615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300032055|Ga0318575_10254865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 885 | Open in IMG/M |
| 3300032059|Ga0318533_10349596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1076 | Open in IMG/M |
| 3300032059|Ga0318533_11235585 | Not Available | 546 | Open in IMG/M |
| 3300032060|Ga0318505_10008340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3596 | Open in IMG/M |
| 3300032063|Ga0318504_10368110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300032064|Ga0318510_10085418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1179 | Open in IMG/M |
| 3300032261|Ga0306920_103685889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.88% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.96% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A100DRAFT_11021771 | 3300000655 | Forest Soil | MSRIIVVTACGFMLAACSVTMPSLSLDFMKPAPQDETLA |
| Ga0008090_157202731 | 3300005363 | Tropical Rainforest Soil | MSRVIAVTVCGIMLAACSATMPSLDFMKSAPQAESLAIES |
| Ga0070699_1003799121 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRVIAVMACGFMLAACSATMPSLDFLKSTPQPETLAIES |
| Ga0070697_1000669451 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRVIAVMACGFMPCGFMLAACSTTMPSLDFMKSAPQAESLAIESEPPGAEAK |
| Ga0066905_1019180861 | 3300005713 | Tropical Forest Soil | MSRVIAVMACGFMLAACSATMPSLDFLKSAPQPETL |
| Ga0066903_1017856003 | 3300005764 | Tropical Forest Soil | MSRVIALMAFGFMPCGFMLAACSTTMPSLDFMKSAPQDESLAIES |
| Ga0066903_1067954081 | 3300005764 | Tropical Forest Soil | MSRGIAVMACGFMLAACSTTMPSLDFMKSAPQAESLAIESEPP |
| Ga0066903_1069661211 | 3300005764 | Tropical Forest Soil | MSRVIAVMACGFMLAACSTTMPSLDFMKSAPQAESLA |
| Ga0066653_102746543 | 3300006791 | Soil | MSRVIAVMACGFMPCGFMLAACSTTMPSLDFMKSAPQAESLAIESEPPGAEAKTSLGQ |
| Ga0075423_129512622 | 3300009162 | Populus Rhizosphere | MSRVIAVMACGLSVAACSASMPSLDFLKSTPHTEALAI |
| Ga0126380_110368751 | 3300010043 | Tropical Forest Soil | MSRVIAVTACGFMLAACSATMPSLSLDFMKSAPQPETL |
| Ga0126384_119312711 | 3300010046 | Tropical Forest Soil | MSRLIAAVASGFLLAACSATMPSLNLDFMKSAPQAETLTIESKPPG |
| Ga0126373_125584171 | 3300010048 | Tropical Forest Soil | MSRVIAITACGFMLAACSATMPSLSLDFMKSAPQAETLAIESEPPG |
| Ga0126370_103136324 | 3300010358 | Tropical Forest Soil | MSRVIAVTACGFMLAACSATMPSLSLDFMKSAPQAETLAIESE |
| Ga0126370_109190922 | 3300010358 | Tropical Forest Soil | MSRVIAVTACGFMLAACSATMPSLSLDFMKSAPQA |
| Ga0126372_103538221 | 3300010360 | Tropical Forest Soil | MSRVIAVTVCGFMLPACSTTMPSLDFMKSAPQAESLAIES |
| Ga0126379_127127181 | 3300010366 | Tropical Forest Soil | MSRVIAVTACGFMLAACSATMPSLSLDFMKSAPQAETLAIE |
| Ga0126383_109471861 | 3300010398 | Tropical Forest Soil | MSRIIAITASGFMLAACSVTMPSLSLDFMKSAPQDETLAIDSEPPAAEAKT |
| Ga0137378_105844312 | 3300012210 | Vadose Zone Soil | MSRVIAVIAGGFMLAACSTTMPSLDFLKSAPQSETLA |
| Ga0162651_1000546071 | 3300012938 | Soil | MGRVIAVMACGFSVAACSASMPSLDFLKSTPQTEALAIETEPP |
| Ga0126375_113471431 | 3300012948 | Tropical Forest Soil | LPPSGGIMSRVIAVVVCGLMVAACSATMPSLDFLKSTPQSETLAIDSEPSG |
| Ga0164299_103343122 | 3300012958 | Soil | MSRVIAVMACGLSVAAGSASMPSLDFLKSNPQTEALAIESEPPG |
| Ga0134087_107760762 | 3300012977 | Grasslands Soil | MSRVIAVTACGLMLGACSAAMPSLDFLKSAPQSETLAIESEPAGA |
| Ga0134079_104298272 | 3300014166 | Grasslands Soil | MSRVIAIMACGFMLTACSATMLNLSLDFMKSAPQAERLA |
| Ga0132256_1030951002 | 3300015372 | Arabidopsis Rhizosphere | MSRVIAIVACGLSVAACSASMPSLDFLKSSPQTEALAIE |
| Ga0132255_1038198392 | 3300015374 | Arabidopsis Rhizosphere | MSRLIAVVACGFMLAACSTTIPSLNLDFMKSAPHAE |
| Ga0182036_112177291 | 3300016270 | Soil | MRRVIAVMACGFMLAACSTTMPSLDFMKSAPQAESLAIESE |
| Ga0182033_100932174 | 3300016319 | Soil | MSRIIAVMASGFMLAACSVTMPSLSLDFMKSAPQDETLAI |
| Ga0182033_103034374 | 3300016319 | Soil | MSPRWWDPIMSRVIAVPVCGFMLAACSTTMPSLDFMKSAPQGESLAIESESPGAEA |
| Ga0182033_116068213 | 3300016319 | Soil | MSRVIAVTTCGFVLAACSATMPSLSLDFMKSAPQAETLAIESEP |
| Ga0182033_120052401 | 3300016319 | Soil | MSRVIAVTACGFMLAACSATMPSLSLDFMKSAPQAET |
| Ga0182032_110990511 | 3300016357 | Soil | MSRVIAVMACGFMLSACSAAMPSLDFLKSTPQPETLAIESEPAGAEA |
| Ga0182032_111709301 | 3300016357 | Soil | MSRVIALMACGFMLAACSATMPSLDFLKSTPQPETLAIESEPP |
| Ga0182034_101767401 | 3300016371 | Soil | MSRVIAVTACGFMLAACSATMPSLSLDFMKSAPQAETLAIESEP |
| Ga0182034_107894182 | 3300016371 | Soil | MSRVIAVTTCGFVLAACSATMPSLSLDFMKSAPQAETLAIES |
| Ga0182040_103105314 | 3300016387 | Soil | MSRVIAVTVCGIMLAACSATMPSLDFMKSAPQAESLAIESE |
| Ga0182040_112458131 | 3300016387 | Soil | MSPRWWDPIMSRVIAVPVCGFMLAACSTTMPSLDFMKSAPQGESLAIESEPP |
| Ga0182037_104606211 | 3300016404 | Soil | AIMSRVIAVMACGFMLAACSTTMPSLDFMKAAPKG |
| Ga0182039_108601281 | 3300016422 | Soil | MPPRWCWIMRRVIAVTACGFMLAACSATMPSLSLDFMKSAPQAETLAIESE |
| Ga0182039_108809922 | 3300016422 | Soil | MSRVIAVMACGFMLSACSAAMPSLDFLKSTPQPETLAIESEPAGAEAK |
| Ga0182038_101079023 | 3300016445 | Soil | MSRLIAVVAWGFMLAACSATMPNLNLDFMKSAPQAETLA |
| Ga0066669_113300292 | 3300018482 | Grasslands Soil | MSRVIAVTACGLMLGACSAAMPSLDFLKSAPQSETLAIESEPAGAKAK |
| Ga0213877_101925841 | 3300021372 | Bulk Soil | MSRVIAVTACGLMLAACSATMPSLSLDFMKSAPQAETLAI |
| Ga0213879_100077004 | 3300021439 | Bulk Soil | MSRIIAITASGFMLAACSVTMPSLSLDFMKSAPQD |
| Ga0187846_104495671 | 3300021476 | Biofilm | MSRVIAVMACGFMLAACSTTMPSLDFMKSAPEAESLAI |
| Ga0210402_100432595 | 3300021478 | Soil | MSRVVAITACGLMLAACSAAMPSLDFLKSAPQSETLAIESDPP |
| Ga0207699_102308074 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VIAILACGFMLTACSATMPSLSLDFMKSAPQAETLAIESEPPSLAVTIIRLAAE |
| Ga0207684_117247411 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRVIAVMACGFMPCGFMLAACSTTMPSLDFMKSAPQAESLAIESEPPGAEA |
| Ga0209801_11807542 | 3300026326 | Soil | MSRLIAVVAWGFMLAACSATMPNLNLDFMKSAPQAETL |
| Ga0179587_105206352 | 3300026557 | Vadose Zone Soil | MSRVIAIVACGFMLTACSATMPSLSLDFMKSTPRPK |
| Ga0209799_10541373 | 3300027654 | Tropical Forest Soil | MSRLIAVVAWGFMLAACSATMPNLNLDFMKSAPQAEMLAIES |
| Ga0137415_111216932 | 3300028536 | Vadose Zone Soil | MSRVIVLMACGLMLAACSATMPSLDFLKSAPQSETLAIE |
| Ga0307322_101700972 | 3300028710 | Soil | MSRVIAIVACGLSVAACSASMPSLDFLKSSPQTEAL |
| Ga0307315_100825211 | 3300028721 | Soil | MSRVIAVMACGFSVAACSASMPSLDFLKSTPQNEALAIETEPPG |
| Ga0307294_100663721 | 3300028810 | Soil | MSRVIAVMACGFSVAACSASMPSLDFLKSTPQTEA |
| Ga0307498_100375811 | 3300031170 | Soil | MSRVIAIMACGFSVAACSASMPSLDFLKSTPQTEALAIETE |
| Ga0318541_102419001 | 3300031545 | Soil | MSRVIAVMACGFMLAACSTTMPSLDFIKSAPEAESLA |
| Ga0318541_106133031 | 3300031545 | Soil | MSRVIAVTACGFMLAACSATMPSLSLDFMKSAPQPET |
| Ga0318528_101053583 | 3300031561 | Soil | MPPRWCWIMRRVIAVTACGFMLAACSATMPSLSLDFMKSAPQAETL |
| Ga0310915_111894571 | 3300031573 | Soil | MSRVIAVMACGFMLTACSATMPSLDFLKSTPQPET |
| Ga0318561_101898381 | 3300031679 | Soil | MSRVIAVMACGFMLAACSTTMPSLDFMKSAPQAESLAIDSE |
| Ga0318574_100276286 | 3300031680 | Soil | MPPRWCWIMRRVIAVTACGFMLAACSATMPSLSLDFMKSAPQA |
| Ga0318560_106563721 | 3300031682 | Soil | MSRVIAVMACGFMLTACSAMMPSLDFLKSTPQPETLAIESEP |
| Ga0318496_104375371 | 3300031713 | Soil | MSRVIALMACGFMLAACSATMPSLDFLKSTPQPETLAI |
| Ga0306917_103397571 | 3300031719 | Soil | MSRVIAVTACGFMLAACSATMPSLSLDFMKSAPQPETLTIESE |
| Ga0306917_104713382 | 3300031719 | Soil | MSRVIAVMACGFMLAACSTTMPSLDFMKSAPQAESLAIESEPAG |
| Ga0306917_108600271 | 3300031719 | Soil | MSRVIAVMACGFMLTACSATMPSLDFLKSTPQPETLAIESEPPG |
| Ga0306917_111472101 | 3300031719 | Soil | MSRVVAVTGCGFMLAACSATIPSLSLDFMKSAPQAET |
| Ga0306917_113011131 | 3300031719 | Soil | MSRVIAVMACGFMLAACSTTMPSLDFIKSAPEAESLAIE |
| Ga0318521_106558171 | 3300031770 | Soil | MSRVIAVTVCGIMLAACSATMPSLDFMKSAPQAESLAIESEP |
| Ga0318546_105368221 | 3300031771 | Soil | MSRAIAVTACGFILAACSATMPSLSLDFMKSAPQPETLTIESEPPGA |
| Ga0318546_107157501 | 3300031771 | Soil | MSRVIAVTACGFMLAACSATMPSLSLDFMTSAPQAETLA |
| Ga0318546_108137821 | 3300031771 | Soil | MSRVIAVMACGFMLSACSAAMPSLDFLKSTPQPETLAIESEP |
| Ga0318547_103600542 | 3300031781 | Soil | MSRIIAVTVCGFMLAACSTTMPSLDFMKSAPQGESLAI |
| Ga0318503_102131943 | 3300031794 | Soil | MSRVVAVTACGFMLAACSATMPSLSLDFMKSAPQAETLAIE |
| Ga0318576_101465544 | 3300031796 | Soil | MSRVIAVTACGFMLAACSATMPSLSLDFMKSAPQAE |
| Ga0318512_101127641 | 3300031846 | Soil | MSRVIAVMACGFMLAACSATMPSLDFLKSTPQPETLAIE |
| Ga0306919_101064471 | 3300031879 | Soil | MSRLIAVVAWGFMLAACSATMPNLNLDFMKSAPQAETLAIES |
| Ga0306919_109541241 | 3300031879 | Soil | MRRVIAVMACGFMLAACSTTMPSLDFMKSAPQAESLAIESEPAG |
| Ga0306919_110699972 | 3300031879 | Soil | MSRVIAVTVCGIMLAACSATMPSLDFMKSAPQAESLAIESEPP |
| Ga0306925_100795763 | 3300031890 | Soil | MSRVIAVTACGFMLAACSATMPSLSLDFMKSAPQAETLAI |
| Ga0306925_121166961 | 3300031890 | Soil | MSRVIAVMACGFMLTACSATMPSLDFLKSTPQPETLA |
| Ga0318536_106194491 | 3300031893 | Soil | MSRVIAVMACGFMLAACSTTMPSLDFMKSAPQAESLAIES |
| Ga0318551_107769142 | 3300031896 | Soil | MSRVIAVTACGFMLTACSATMPSLSLDFMKSAPQAETLAIESEPPG |
| Ga0318520_110165371 | 3300031897 | Soil | MSRVIAVTVCGFMLAACSTTMPSLDFMKSAPQAESL |
| Ga0306923_104702122 | 3300031910 | Soil | MSRLIAVVAWGFMLAACSATMPNLNLDFMKSAPQAETLAIESEPPGA |
| Ga0306923_109407462 | 3300031910 | Soil | MSRVIAVMACGFMLAACSTTMPSLDFMKSAPQAESLAI |
| Ga0310912_101662631 | 3300031941 | Soil | MSRVIAVTACGFMLAACSATMPSLSLDFMKSAPQAETLAIESEPPG |
| Ga0310912_114762142 | 3300031941 | Soil | MSRVIAVTTCGFVLAACSATMPSLSLDFMKSAPQAETLAIE |
| Ga0310913_109373611 | 3300031945 | Soil | MSRIIAVMASGFMLAACSVTMPSLSLDFMKSAPQDETLAIESEPPAAEAK |
| Ga0310913_110856353 | 3300031945 | Soil | MSRVVAVTACGFMLAACSATMPSLSLDFMKSAPQAETLAI |
| Ga0306922_104009391 | 3300032001 | Soil | VSRVIAVMACGLMPCGLMLAACSTTMPSLDFMKSAPQAESL |
| Ga0306922_117838283 | 3300032001 | Soil | MSRAIAVMAFGFMPCGFMLAACSTTMPSLDFMKSAPQAESLAIESEPSGA |
| Ga0306922_121949701 | 3300032001 | Soil | MSRVIAVTTCGFVLAACSATMPSLSLDFMKSAPQAETLAIESEPP |
| Ga0318569_101926891 | 3300032010 | Soil | MSRVIAVMACGFMLAACSATMPSLDFLKSTPQPEAL |
| Ga0318559_101283044 | 3300032039 | Soil | MSRIIAVTVCGFMLAACSTTMPSLDFMKSAPQVESLTIES |
| Ga0318558_105556151 | 3300032044 | Soil | MPPRWCWIMRRVIAVTACGFMLAACSATMPSLSLDFMKSAPQAE |
| Ga0318575_102548651 | 3300032055 | Soil | MSRVIAVIACGFTLAACSTTMPSLDFMKSAPQSEMLA |
| Ga0318533_103495961 | 3300032059 | Soil | MSRVIAVTACGFMLAACSATMPSLSLDFMKSAPQPETLA |
| Ga0318533_112355851 | 3300032059 | Soil | MSRVIAVTTCGFVLAACSATMPSLSLDFMKSAPQAETLAIESEPPG |
| Ga0318505_100083405 | 3300032060 | Soil | MRRVIAVMACGFMLAACSTTMPSLDFMKSAPQAES |
| Ga0318504_103681104 | 3300032063 | Soil | MSRVVAVTGCGFMLAACSATIPSLSLDFMKSVPQAE |
| Ga0318510_100854184 | 3300032064 | Soil | MSRVIAVTACGFMLAACSATMPSLSLDFMKSAPQPE |
| Ga0306920_1036858891 | 3300032261 | Soil | MSRVIAVTACGFMLAACSATMPSLSLDFMKSAPQPETLTI |
| ⦗Top⦘ |