


| Basic Information | |
|---|---|
| Family ID | F096923 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKTIGIVLLWFVFIGVLASFVSCASGHHCDAYGQTKQVETKTVSK |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 24.04 % |
| % of genes from short scaffolds (< 2000 bps) | 70.19 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.115 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (36.538 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.385 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (68.269 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 54.79% β-sheet: 0.00% Coil/Unstructured: 45.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF01832 | Glucosaminidase | 8.65 |
| PF04851 | ResIII | 3.85 |
| PF12705 | PDDEXK_1 | 2.88 |
| PF02617 | ClpS | 0.96 |
| PF00136 | DNA_pol_B | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.96 |
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.12 % |
| All Organisms | root | All Organisms | 27.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 36.54% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.42% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.73% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.77% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 4.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.85% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.85% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 3.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.92% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.96% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.96% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.96% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.96% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.96% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.96% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.96% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000126 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 26_20.5m | Environmental | Open in IMG/M |
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300010233 | Filterable freshwater microbial communities from Conwy River, North Wales, UK. Fraction, filtered through 0.2 um filter. After WGA. | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012711 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012719 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012752 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES162 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020511 | Freshwater microbial communities from Lake Mendota, WI - 15JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300022173 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM15.D.D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024555 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024556 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024859 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BS_KBB_SWE26_205mDRAFT_10050392 | 3300000126 | Marine | MKTIGIVLAWFVFIGLLASFVSCSSTVHCDAYGQTEQVQNKSVSK* |
| JGI12547J11936_10051422 | 3300000736 | Freshwater And Sediment | MKTIAIVVLWFVFIGVLATFVSCASGHHCDAYGQTKQVETKTVSK* |
| GOS2236_10107743 | 3300001968 | Marine | MKTVGILVLWFASIITLAVLVSCGSTHHCDAYGQTEHIQNKSVSK* |
| B570J40625_1009800302 | 3300002835 | Freshwater | MKTIGIVLLWFVFIGILASFVSCASGHQCDAYGQEKQIETKTVSK* |
| Ga0007761_100373475 | 3300004792 | Freshwater Lake | MKTIGIVILWFVFVGALASLVSCSSAVHCDAYGQTKQIETKTVSK* |
| Ga0007760_100126575 | 3300004793 | Freshwater Lake | MIMKTIAIVLLWFVFIGVLASFVSCASGHHCDAYGQTKQVETKTVSK* |
| Ga0068876_100174378 | 3300005527 | Freshwater Lake | MKTIGIVLAWFVFIGVLASFVSCSSTVHCDAYGQTEQVQNKTVSK* |
| Ga0068876_103338642 | 3300005527 | Freshwater Lake | MKTIGIVLLWFVFIGILASFVSCASGHQCDAYGQTEQVENRTVSK* |
| Ga0078894_112284343 | 3300005662 | Freshwater Lake | MKTIGIVLLWFVFIGVLASFVSCASGHHCDAYGQTKQVETKTVSK* |
| Ga0070749_100369784 | 3300006802 | Aqueous | MKTIGIVVLWFVFIGVLASLVSCASGHHCDAYGQTKQVETKTVSK* |
| Ga0070746_100112963 | 3300006919 | Aqueous | MKTIGIVVLWFVFIGVLASLVSCASGHHCDAYGQTKQVESKTVSR* |
| Ga0099848_10089883 | 3300007541 | Aqueous | MKTIGIIIAWFVFIGVLASFVSCSSTVHCDAYGQTEQLQNKSVSK* |
| Ga0105747_11584812 | 3300007974 | Estuary Water | MKTIGLVLLWFVVMGVLATFVSCGSAYHCDAYGQTEQVETKTVSR* |
| Ga0114340_10629677 | 3300008107 | Freshwater, Plankton | MIYPFNKIIMKTIGIVLAWFVFIGVLASFVSCSSTVHCDAYGQTEQVQNKTVSK* |
| Ga0114341_100250037 | 3300008108 | Freshwater, Plankton | MIYPFNKIIMKTIGIVLAWFVFIGVLASFVSCSSTVHCDAYGQTEQVQNKSVSK* |
| Ga0114337_10086343 | 3300008262 | Freshwater, Plankton | MIYPFNKIIMKTIGIVLAWFVFIGVLASFVSCSSTVHCDAYGQTEQVQNKTISK* |
| Ga0114337_10653413 | 3300008262 | Freshwater, Plankton | MIMKTIGIVLLWFVFIGILASFVSCASGHQCDAYGQTEQVENRTVSK* |
| Ga0114363_10086141 | 3300008266 | Freshwater, Plankton | IMKTIGIVLLWFVFIGILASFVSCASGHQCDAYGQTEQVENRTVSK* |
| Ga0114363_11358531 | 3300008266 | Freshwater, Plankton | MKTIGIVLLWFVFIGILASFVSCASGHQCDAYGQTEQ |
| Ga0114364_100430515 | 3300008267 | Freshwater, Plankton | MKTIGIVLLWFVFIGILASFVSCASGHHCDAYGQTKQVETKTVSK* |
| Ga0114876_10315966 | 3300008448 | Freshwater Lake | MKTIGIVLLWFVFIGVLASFVSCASGHQCDAYGQTEQVENRTVSK* |
| Ga0114876_10375163 | 3300008448 | Freshwater Lake | MKTIGIVLLWFVFIGVLASFVSCTTTHHCDAYGQTEQVQNKSVSK* |
| Ga0114876_10517407 | 3300008448 | Freshwater Lake | IVLLWFVFIGILASFVSCASGHHCDAYGQTKQVETKTVSK* |
| Ga0114876_11315504 | 3300008448 | Freshwater Lake | MKTIGIVLAWFLFIGVLASFVSCASSHHCDAYGQTEHVQNKSVSK* |
| Ga0114876_12256072 | 3300008448 | Freshwater Lake | MKTIGIVLAWFVFIGVLASFVSCTTTHHCDAYGQTEQVQNKSVSK* |
| Ga0105103_102954122 | 3300009085 | Freshwater Sediment | MIMKAIGIVLLWFVVMGALATFVSCGSAHHCDAYGQTEQVETKTVSR* |
| Ga0114918_107320412 | 3300009149 | Deep Subsurface | MIMKTIGIVLAWFLFIGLLASFVSCSSTVHCDAYGQTEQVQNKSVSK* |
| Ga0114979_100181463 | 3300009180 | Freshwater Lake | MKTIAIVVLWFLFIGVLASFVSCGTTHHCDAYGQTKQVQNKTVSK* |
| Ga0114919_102598804 | 3300009529 | Deep Subsurface | MKTIGIVLAWFLFIGLLASFVSCGSSVHCDAYGQTEQVQNKSVSK* |
| Ga0136235_10383465 | 3300010233 | Freshwater | MKTVGIVLVWFVFIGILASFISCGSTIHCDAYGQTEQVQNKSVSK* |
| Ga0153799_100061411 | 3300012012 | Freshwater | MKTIAIVVLWFVFIGVLATFVSCGSTHQCDAYGQTKQVETKTVSK* |
| Ga0153805_10317075 | 3300012013 | Surface Ice | VVLWFVFIGVLATFVSCGSTHQCDAYGQTKQVETKTVSK* |
| Ga0153801_10341542 | 3300012017 | Freshwater | MKTITIVLLWFVFIGVLASFVSCASGHQCDAYGQTKQVETKTVSK* |
| Ga0157607_11166723 | 3300012711 | Freshwater | FNKIIMKTIGIVLAWFVFIGVLASFVSCSSTVHCDAYGQTEQVQNKTVSK* |
| Ga0157600_11283663 | 3300012719 | Freshwater | FVFIGVLASFVSCSSTVHCDAYGQTEQVQNKTVSK* |
| Ga0157610_10869854 | 3300012725 | Freshwater | MIYPFNKIIMKTIGIVLAWFVFIGVLASFVSCSSTVHCDAYGQTEQ |
| Ga0157606_13288823 | 3300012733 | Freshwater | AWFVFIGVLASFVSCSSTVHCDAYGQTEQVQNKTVSK* |
| Ga0157629_10325111 | 3300012752 | Freshwater | IMKTIGIVLAWFVFIGVLASFVSCSSTVHCDAYGQTEQVQNKTVSK* |
| Ga0177922_101864472 | 3300013372 | Freshwater | MKTIAIVLLWFVFIGVLASFVSCASGHQCDAYGQTKQVETKTVSK* |
| Ga0181338_10020833 | 3300015050 | Freshwater Lake | MIMKAIGIVLLWFVFIGVLASFVSCSSAHHCDAYGQTEQVETKTISK* |
| Ga0181338_10097054 | 3300015050 | Freshwater Lake | MIMKAIGIVLLWFVFIGVLASFVSCGSAHHCDAYGKTEQIETKTVSK* |
| Ga0181339_10119391 | 3300017700 | Freshwater Lake | MKTIGIVLLWFVFIGVLASFVSCSSAHHCDAYGQTEQVDF |
| Ga0181339_10321453 | 3300017700 | Freshwater Lake | MKAIGIVLLWFVVMGALATFVSCGSTHHCDAYGQTEQVETKTVSK |
| Ga0181350_10285222 | 3300017716 | Freshwater Lake | MIMKTIGIVLLWFVFIGVLATFVSCGSTHQCDAYGQTKQVETKTVSK |
| Ga0181350_10573614 | 3300017716 | Freshwater Lake | RFTLLKIMIMKAIGIVLLWFVFIGVLASFVSCGSAHHCDAYGKTEQIETKTVSK |
| Ga0181365_11227832 | 3300017736 | Freshwater Lake | MKAIGIVLLWFVFIGVLASFVSCGSAHHCDAYGQTEQVETKTVSK |
| Ga0181344_10234763 | 3300017754 | Freshwater Lake | MKTIGIVVLWFVFIGVLASFVSCASGHQCDAYGQTKQIETKTVSK |
| Ga0181344_10248744 | 3300017754 | Freshwater Lake | MKTIAIVLGWFVFIGVLASLVSCGSSHHCDAYGNTEQVQTKNVSR |
| Ga0181344_10512183 | 3300017754 | Freshwater Lake | MKTIGIVVLWFVFIGVLASFVSCASGHHCDAYGQTKQVETKTVSR |
| Ga0181344_10555315 | 3300017754 | Freshwater Lake | MKTIGIVLLWFVFIGVLASFVSCASGHQCDAYGQTKQVQNKTVSK |
| Ga0181344_11001522 | 3300017754 | Freshwater Lake | MKTIGIVLLWFVFIGVLASFVSCASGHHCDAYGQTKQVQTKNVSR |
| Ga0181344_11815112 | 3300017754 | Freshwater Lake | MKTLGIVLLWFLFIGVLASFVSCASGHHCDAYGQTKQVQKKDISK |
| Ga0181356_11869004 | 3300017761 | Freshwater Lake | LWFVFIGVLASFVSCASGHHCDAYGQTKQVETKTVSK |
| Ga0181356_12150082 | 3300017761 | Freshwater Lake | MIMKTIAIVVLWFVFIGVLASFVSCASGHHCDAYGQTKQVETKTVSKXFT |
| Ga0181356_12150762 | 3300017761 | Freshwater Lake | MIMKTIAIVLLWFVFIGVLASFVSCASGHHCDAYGQTKQVETKTVSKXFT |
| Ga0181343_11543303 | 3300017766 | Freshwater Lake | MKTIGIVILWFVFIGVLASFVSCASGHHCDAYGQTKQVETKTVSKXFTESLEN |
| Ga0181357_10195716 | 3300017777 | Freshwater Lake | MKAIGIVLLWFVFIGVLASFVSCGSAHHCDAYGKTKQIETKTVSK |
| Ga0181348_11937763 | 3300017784 | Freshwater Lake | RFTLLKFMIMKAIGIVLLWFVFIGVLASFVSCGSTHQCDAYGQTKQVETKTVSK |
| Ga0181360_1060262 | 3300019781 | Freshwater Lake | MIMKAIGIVLLWFVFIGVLASFVSCGSAHHCDAYGKTEQIETKTVSK |
| Ga0181361_1015942 | 3300019783 | Freshwater Lake | MIMKAIGIVLLWFVVMGALATFVSCGSAHHCDAYGQTEQVETKTVSK |
| Ga0181361_1027462 | 3300019783 | Freshwater Lake | MIMKTIGIVLLWFVFIGVLASFVSCSSAHHCDAYGQTEQVETKTISK |
| Ga0181361_1140643 | 3300019783 | Freshwater Lake | MIMKAIGIVLLWFVFIGVLASFVSCGSAHHCDAYGQTEQVETKTVSK |
| Ga0181359_100492910 | 3300019784 | Freshwater Lake | MKTIGIVILWFVFVGALASLVSCSSAVHCDAYGQTKQIETKTVSK |
| Ga0181359_10676935 | 3300019784 | Freshwater Lake | MIMKTIAIVLLWFVFIGVLASFVSCASGHHCDAYGQTKQVETKTVSK |
| Ga0208593_10412471 | 3300020511 | Freshwater | KKRVMKTIGIVLAWFVFIGVLASFVSCTTTHHCDAYGQTEQVQNKSVSK |
| Ga0181337_10298901 | 3300022173 | Freshwater Lake | MKAIGIVLLWFVFIGVLASFVSCGSTHQCDAYGKTEQIETKTVSK |
| Ga0181354_11855863 | 3300022190 | Freshwater Lake | MKTIAIVLLWFVFIGVLASFVSCASGHHCDAYGQTKQVETKTVSK |
| Ga0210003_10567345 | 3300024262 | Deep Subsurface | MIMKTIGIVLAWFLFIGLLASFVSCSSTVHCDAYGQTEQVQNKSVSK |
| Ga0209986_103255972 | 3300024433 | Deep Subsurface | MIMKTIGIVLAWFLFIGLLASFVSCGSSVHCDAYGQTEQVQNKSVSK |
| Ga0255280_10049314 | 3300024555 | Freshwater | MKTVGILLLWFTSIITLAILVSCGSTHHCDAYGQTEHIQNKSVSK |
| Ga0256341_10211236 | 3300024556 | Freshwater | MKTIAIILAWFLFIGTLATLVSCASGHHCDAYGQTETIHSKTVSK |
| Ga0255283_10940074 | 3300024557 | Freshwater | MKTVGILLLWFTSIITLAILVSCGSTHHCDAYGQTEHIQNKSV |
| Ga0255278_11060222 | 3300024859 | Freshwater | MITSMKTVGILLLWFTSIITLAILVSCGSTHHCDAYGQTEHIQNKSVSK |
| Ga0208161_10916514 | 3300025646 | Aqueous | FKERIMKTIGIIIAWFVFIGVLASFVSCSSTVHCDAYGQTEQVQNKSVSK |
| Ga0208767_10174693 | 3300025769 | Aqueous | MKTIGIVVLWFVFIGVLASLVSCASGHHCDAYGQTKQVETKTVRN |
| Ga0209247_10385522 | 3300027468 | Freshwater Lake | MKAIGIVLLWFVFIGVLASFVSCGSAHHCDAYGKTEQIETKTVSK |
| Ga0209357_11245594 | 3300027656 | Freshwater Lake | VLLWFVFIGVLASFVSCASGHHCDAYGQTKQVETKTVSK |
| Ga0209088_1000003021 | 3300027763 | Freshwater Lake | MIMKTIAIVVLWFLFIGVLASFVSCGTTHHCDAYGQTKQVQNKTVSK |
| Ga0209768_103668863 | 3300027772 | Freshwater Lake | LKIMIMKAIGIVLLWFVFIGVLASFVSCGSAHHCDAYGKTEQIETKTVSK |
| Ga0209246_100302307 | 3300027785 | Freshwater Lake | IMKAIGIVLLWFVFIGVLASFVSCGSTHQCDAYGQTKQVETKTVSK |
| Ga0209107_1000001119 | 3300027797 | Freshwater And Sediment | MIMKTIAIVVLWFVFIGVLATFVSCASGHHCDAYGQTKQVETKTVSK |
| Ga0209990_102262603 | 3300027816 | Freshwater Lake | MKTIGIVLLWFVFIGILASFVSCASGHQCDAYGQTEQVENRTVSK |
| Ga0209990_103620061 | 3300027816 | Freshwater Lake | MKTIGIVLAWFVFIGVLASFVSCSSTVHCDAYGQTEQVQNKTVSK |
| Ga0209668_100217553 | 3300027899 | Freshwater Lake Sediment | MKTIGIVVLWFVFIGVLASFVSCASGHHCDAYGQTKQVETKTVSK |
| (restricted) Ga0247834_10956011 | 3300027977 | Freshwater | MKTVGIVLVWFVFIGILASFVSCGSSYHCDAYGQTEQVQNKSVSK |
| Ga0307380_1005811511 | 3300031539 | Soil | MKTIGIVLAWFLFIGLLASFVSCSSTVHCDAYGQTEQVQNKSVSK |
| Ga0307380_114340811 | 3300031539 | Soil | MIMKTIGIVLAWFLFIGVLACFVSCGSTVHCDAYGQTEQVQNKSVSK |
| Ga0307379_102306027 | 3300031565 | Soil | LAWFVFIGLLASFVSCSSTVHCDAYGQTEQVQNKSVSK |
| Ga0307376_108267373 | 3300031578 | Soil | MKTIGIVLAWFLFIGILASFVSCSSTVHCDAYGQTEQVQNKSVSK |
| Ga0307377_103505133 | 3300031673 | Soil | MKTIGIVLLWFLFIGVIACFVSCGSSHHCDAYGQTEQVQNKSVSK |
| Ga0315899_112514023 | 3300031784 | Freshwater | MKTIGIVLLWFVFIGVLASFVSCASGHQCDAYGQTEQVENRTVSK |
| Ga0315900_1000253436 | 3300031787 | Freshwater | MIMKTIGIVLLWFVFIGILASFVSCASGHQCDAYGQTEQVENRTVSK |
| Ga0315901_100560039 | 3300031963 | Freshwater | MKTIGIVLAWFVFIGVLASFVSCSSTVHCDAYGQTEQVQNKSVSK |
| Ga0315902_104466463 | 3300032093 | Freshwater | MKTIGIVLAWFVFIGVLASFVSCSSTVHCDAYGQTEQVQNKTIS |
| Ga0334996_0128687_764_907 | 3300033994 | Freshwater | MIMKTIAIVLLWFVFIGVLASFVSCASGHQCDAYGQTKQVETKTVSK |
| Ga0334979_0000025_112538_112702 | 3300033996 | Freshwater | MIYPFNKIIMKTIGIVLAWFVFIGVLASFVSCSSTVHCDAYGQTEQVQNKTVSK |
| Ga0334979_0105334_1281_1418 | 3300033996 | Freshwater | MKTIGIVLAWFVFIGVLASFVSCTTTHHCDAYGQTEQVQNKSVSK |
| Ga0335028_0133440_675_812 | 3300034071 | Freshwater | MKTIGIVVLWFVFIGVLASFVSCASGHQCDAYGQTKQVETKTVSK |
| Ga0335031_0286759_201_338 | 3300034104 | Freshwater | MKTIGIVILWFVFIGVLASFVSCASGHQCDAYSQEKQVETKTVSK |
| Ga0335053_0321962_845_961 | 3300034118 | Freshwater | MKTIGIVLLWFVFIGILASFVSCASGHHCDAYGQTKQVE |
| Ga0335049_0088000_1016_1159 | 3300034272 | Freshwater | MIMKTIGIVLLWFVFIGILASFVSCASGHHCDAYGQTKQVETKTVSK |
| Ga0335049_0675885_369_512 | 3300034272 | Freshwater | MIMKTIGLVLLWFVVMGALSTLVSCGSAHHCDAYGQTEQVETKTVSR |
| Ga0335049_0704398_253_396 | 3300034272 | Freshwater | MIMKTIAIVLGWFVFIGVLASLVSCGSTHHCDAYGKTEQVQTKNVSR |
| Ga0348337_038175_385_528 | 3300034418 | Aqueous | MIMKTIGIVVLWFVFIGVLASLVSCASGHHCDAYGQTKQVETKTVSK |
| ⦗Top⦘ |