


| Basic Information | |
|---|---|
| Family ID | F096867 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 47 residues |
| Representative Sequence | DLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.96 % |
| % of genes near scaffold ends (potentially truncated) | 93.27 % |
| % of genes from short scaffolds (< 2000 bps) | 93.27 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.654 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (23.077 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.346 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (41.346 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.28% β-sheet: 0.00% Coil/Unstructured: 84.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00534 | Glycos_transf_1 | 7.69 |
| PF07603 | DUF1566 | 0.96 |
| PF13692 | Glyco_trans_1_4 | 0.96 |
| PF08299 | Bac_DnaA_C | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.65 % |
| All Organisms | root | All Organisms | 41.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001267|B570J13875_101937 | Not Available | 1156 | Open in IMG/M |
| 3300002201|metazooDRAFT_1275721 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 939 | Open in IMG/M |
| 3300002408|B570J29032_109165548 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 618 | Open in IMG/M |
| 3300002835|B570J40625_100313391 | Not Available | 1581 | Open in IMG/M |
| 3300005581|Ga0049081_10284814 | Not Available | 572 | Open in IMG/M |
| 3300005582|Ga0049080_10167643 | Not Available | 732 | Open in IMG/M |
| 3300005940|Ga0073913_10027703 | Not Available | 843 | Open in IMG/M |
| 3300006030|Ga0075470_10138367 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 715 | Open in IMG/M |
| 3300006805|Ga0075464_10388089 | Not Available | 847 | Open in IMG/M |
| 3300006863|Ga0075459_1065145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300006875|Ga0075473_10059141 | Not Available | 1489 | Open in IMG/M |
| 3300006875|Ga0075473_10059870 | All Organisms → Viruses | 1480 | Open in IMG/M |
| 3300006917|Ga0075472_10057560 | All Organisms → Viruses → Predicted Viral | 1851 | Open in IMG/M |
| 3300006917|Ga0075472_10238643 | Not Available | 895 | Open in IMG/M |
| 3300007541|Ga0099848_1184294 | Not Available | 756 | Open in IMG/M |
| 3300007547|Ga0102875_1053067 | Not Available | 1324 | Open in IMG/M |
| 3300007551|Ga0102881_1061919 | Not Available | 1044 | Open in IMG/M |
| 3300007551|Ga0102881_1140265 | Not Available | 668 | Open in IMG/M |
| 3300007593|Ga0102918_1100874 | Not Available | 858 | Open in IMG/M |
| 3300007597|Ga0102919_1122030 | Not Available | 820 | Open in IMG/M |
| 3300007600|Ga0102920_1018863 | All Organisms → Viruses → Predicted Viral | 2063 | Open in IMG/M |
| 3300007618|Ga0102896_1093828 | Not Available | 980 | Open in IMG/M |
| 3300007620|Ga0102871_1231690 | Not Available | 511 | Open in IMG/M |
| 3300007716|Ga0102867_1042930 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
| 3300007960|Ga0099850_1275386 | Not Available | 643 | Open in IMG/M |
| 3300007973|Ga0105746_1007948 | All Organisms → Viruses → Predicted Viral | 2970 | Open in IMG/M |
| 3300007974|Ga0105747_1018314 | All Organisms → Viruses → Predicted Viral | 1897 | Open in IMG/M |
| 3300008055|Ga0108970_11232783 | Not Available | 827 | Open in IMG/M |
| 3300008116|Ga0114350_1189224 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 520 | Open in IMG/M |
| 3300008264|Ga0114353_1397905 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 511 | Open in IMG/M |
| 3300008265|Ga0114361_1075686 | Not Available | 1045 | Open in IMG/M |
| 3300008339|Ga0114878_1014838 | Not Available | 3779 | Open in IMG/M |
| 3300008510|Ga0110928_1035587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1595 | Open in IMG/M |
| 3300009081|Ga0105098_10396184 | Not Available | 684 | Open in IMG/M |
| 3300009165|Ga0105102_10623884 | Not Available | 598 | Open in IMG/M |
| 3300010354|Ga0129333_10149220 | All Organisms → cellular organisms → Bacteria | 2146 | Open in IMG/M |
| 3300010354|Ga0129333_10309517 | Not Available | 1412 | Open in IMG/M |
| 3300010354|Ga0129333_11646178 | Not Available | 523 | Open in IMG/M |
| 3300010368|Ga0129324_10361053 | Not Available | 564 | Open in IMG/M |
| 3300012013|Ga0153805_1062066 | Not Available | 633 | Open in IMG/M |
| 3300012716|Ga0157605_1214039 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 575 | Open in IMG/M |
| 3300012729|Ga0157625_1198715 | Not Available | 814 | Open in IMG/M |
| 3300012757|Ga0157628_1130058 | Not Available | 814 | Open in IMG/M |
| 3300012988|Ga0164306_11088568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300013004|Ga0164293_10129473 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_6 | 1900 | Open in IMG/M |
| 3300013074|Ga0157618_1104954 | Not Available | 609 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10559064 | Not Available | 620 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10728656 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 520 | Open in IMG/M |
| (restricted) 3300013130|Ga0172363_10799406 | Not Available | 587 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10420282 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 907 | Open in IMG/M |
| (restricted) 3300013133|Ga0172362_10660458 | Not Available | 704 | Open in IMG/M |
| (restricted) 3300013137|Ga0172375_10548656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300013295|Ga0170791_10996272 | Not Available | 701 | Open in IMG/M |
| 3300017774|Ga0181358_1172371 | Not Available | 725 | Open in IMG/M |
| 3300017777|Ga0181357_1287924 | Not Available | 561 | Open in IMG/M |
| 3300017785|Ga0181355_1129908 | Not Available | 1026 | Open in IMG/M |
| 3300020083|Ga0194111_10774925 | Not Available | 581 | Open in IMG/M |
| 3300020084|Ga0194110_10225605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1389 | Open in IMG/M |
| 3300020183|Ga0194115_10366697 | Not Available | 631 | Open in IMG/M |
| 3300020198|Ga0194120_10333506 | Not Available | 744 | Open in IMG/M |
| 3300020570|Ga0208465_1000972 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_6 | 6653 | Open in IMG/M |
| 3300020571|Ga0208723_1040115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
| 3300020578|Ga0194129_10284906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
| 3300021093|Ga0194123_10182474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
| 3300021961|Ga0222714_10641950 | Not Available | 525 | Open in IMG/M |
| 3300021962|Ga0222713_10135658 | All Organisms → Viruses → Predicted Viral | 1717 | Open in IMG/M |
| 3300021963|Ga0222712_10107156 | All Organisms → cellular organisms → Bacteria | 1944 | Open in IMG/M |
| 3300022748|Ga0228702_1023733 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_6 | 1964 | Open in IMG/M |
| 3300024510|Ga0255187_1054752 | Not Available | 534 | Open in IMG/M |
| 3300024512|Ga0255186_1042513 | Not Available | 606 | Open in IMG/M |
| 3300024571|Ga0256302_1081717 | Not Available | 760 | Open in IMG/M |
| 3300025630|Ga0208004_1115655 | Not Available | 620 | Open in IMG/M |
| 3300025889|Ga0208644_1190317 | Not Available | 901 | Open in IMG/M |
| 3300027260|Ga0208027_1067248 | Not Available | 704 | Open in IMG/M |
| 3300027281|Ga0208440_1066618 | Not Available | 766 | Open in IMG/M |
| 3300027294|Ga0208441_1064235 | Not Available | 787 | Open in IMG/M |
| 3300027304|Ga0208810_1038070 | Not Available | 1084 | Open in IMG/M |
| 3300027492|Ga0255093_1059967 | Not Available | 728 | Open in IMG/M |
| 3300027608|Ga0208974_1115971 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 703 | Open in IMG/M |
| 3300027798|Ga0209353_10074586 | All Organisms → Viruses → Predicted Viral | 1543 | Open in IMG/M |
| 3300027973|Ga0209298_10346579 | Not Available | 569 | Open in IMG/M |
| 3300029930|Ga0119944_1015912 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1068 | Open in IMG/M |
| 3300031951|Ga0315904_10209789 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_6 | 1903 | Open in IMG/M |
| 3300031951|Ga0315904_11181022 | Not Available | 589 | Open in IMG/M |
| 3300032050|Ga0315906_10273601 | All Organisms → Viruses → Predicted Viral | 1537 | Open in IMG/M |
| 3300032050|Ga0315906_11014865 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 622 | Open in IMG/M |
| 3300032092|Ga0315905_10000926 | Not Available | 31972 | Open in IMG/M |
| 3300032116|Ga0315903_10296603 | Not Available | 1368 | Open in IMG/M |
| 3300033981|Ga0334982_0178333 | All Organisms → Viruses → Predicted Viral | 1063 | Open in IMG/M |
| 3300034012|Ga0334986_0598861 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 525 | Open in IMG/M |
| 3300034023|Ga0335021_0652292 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 517 | Open in IMG/M |
| 3300034061|Ga0334987_0123994 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_6 | 1939 | Open in IMG/M |
| 3300034061|Ga0334987_0359111 | Not Available | 939 | Open in IMG/M |
| 3300034062|Ga0334995_0649180 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 603 | Open in IMG/M |
| 3300034073|Ga0310130_0016703 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_6 | 2400 | Open in IMG/M |
| 3300034094|Ga0335014_0123238 | Not Available | 1290 | Open in IMG/M |
| 3300034101|Ga0335027_0382553 | Not Available | 919 | Open in IMG/M |
| 3300034101|Ga0335027_0495275 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 768 | Open in IMG/M |
| 3300034101|Ga0335027_0507729 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 754 | Open in IMG/M |
| 3300034106|Ga0335036_0472189 | Not Available | 788 | Open in IMG/M |
| 3300034111|Ga0335063_0342863 | Not Available | 775 | Open in IMG/M |
| 3300034112|Ga0335066_0324754 | Not Available | 862 | Open in IMG/M |
| 3300034119|Ga0335054_0478344 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 700 | Open in IMG/M |
| 3300034122|Ga0335060_0133755 | Not Available | 1460 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 23.08% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 12.50% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.58% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.85% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 3.85% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.85% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.85% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.88% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.88% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.92% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.92% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.92% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.96% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.96% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.96% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.96% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.96% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001267 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002201 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2013 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
| 3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008510 | Microbial Communities in Water bodies, Singapore - Site RA | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012729 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012757 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013074 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES147 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300024510 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300024512 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300024571 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027260 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027281 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027294 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027304 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027492 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034094 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Sep2000-rr0077 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J13875_1019371 | 3300001267 | Freshwater | IFYARENDEIRSIAAFKAGVQIAWPDLVVDFRLT* |
| metazooDRAFT_12757213 | 3300002201 | Lake | FFYGTDLLSDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFRLA* |
| B570J29032_1091655482 | 3300002408 | Freshwater | TYLGNLFYGTDLLSDEENFELWYSKDNDEVRFQAAFKAGVQFAYPDLMVDFRLA* |
| B570J40625_1003133911 | 3300002835 | Freshwater | DEENFELWYSKDNDEVRFQAAFKAGVQFAYPDLMVDFKLA* |
| Ga0049081_102848141 | 3300005581 | Freshwater Lentic | YGTDLLSDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFKLA* |
| Ga0049080_101676431 | 3300005582 | Freshwater Lentic | FYGTDLLSDEEQFSIWLSRDNDSIRYQAAFKAGVNFAYPDLMVDFRLA* |
| Ga0073913_100277031 | 3300005940 | Sand | NRIVCTYLGNLFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT* |
| Ga0075470_101383671 | 3300006030 | Aqueous | TYLGNLFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQFAYPDLIVDFRLT* |
| Ga0075464_103880893 | 3300006805 | Aqueous | EEQFSIWFSKDNDEVRFQAAFKAGVQFAYPDLIVDFRLT* |
| Ga0075459_10651451 | 3300006863 | Aqueous | RIVCTYLGNLFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQFAYPDQIVDFRLT* |
| Ga0075473_100591411 | 3300006875 | Aqueous | EQFSIWFSKDNDEVRFQAAFKAGVQFAYPDLIVDFRLT* |
| Ga0075473_100598701 | 3300006875 | Aqueous | LWYSKDNDEVRFQAAFKAGVQFAYPDLMVDFRLA* |
| Ga0075472_100575603 | 3300006917 | Aqueous | SIWPSIDNDEIRFQCALKCGVQVAYPDLVVDWRLA* |
| Ga0075472_102386433 | 3300006917 | Aqueous | LSDEEQFSIWFSKDNDEVRFQAAFKAGVQFAYPDLIVDFRLT* |
| Ga0099848_11842942 | 3300007541 | Aqueous | TNTNRIVCSYLGNFFLGTDLLSDEEQFSIFYARENDEVRSIAAFKCGVQIAYPDLVVDFKLA* |
| Ga0102875_10530671 | 3300007547 | Estuarine | NRMVCSYLGNFFYGTDLLSDEEQFSIWPSIDNDEIRFQCALKCGVQVAYPDLVVDWRLA* |
| Ga0102881_10619191 | 3300007551 | Estuarine | TYLGNLVYATDLLSDEEQFSIFYARENDEVRSIAAFKAGVQIAYPDFVVDFRLA* |
| Ga0102881_11402652 | 3300007551 | Estuarine | YGTDLLSDEEQFSIFYARENDEIRSIAAFKAGVQIAYPDLVVDFRLT* |
| Ga0102918_11008742 | 3300007593 | Estuarine | YGTDLLSDEEQFSIFYARENDEVRSIAAFKAGVQIAYPDFVVDFRLA* |
| Ga0102919_11220302 | 3300007597 | Estuarine | YQGNFFYGTDLLSDEDQFNMWYSQDNDEVRFMAAFKMGVQMAYPDLVVQFRLATS* |
| Ga0102920_10188631 | 3300007600 | Estuarine | DEEQFSIWFSKDNDEVRFQAAFKAGVQFAYPDLIVDFRLT* |
| Ga0102896_10938281 | 3300007618 | Estuarine | TDLLSDEEQFSIWPSIDNDEIRFQCALKCGVQVAYPDLVVDWRLA* |
| Ga0102871_12316901 | 3300007620 | Estuarine | IVCTYLGNLFYASDLLSDEEQFSIFYARENDEVRSIAAFKAGVQTAYPDLVVDFRLA* |
| Ga0102867_10429301 | 3300007716 | Estuarine | NRIVSSYLGNFFYGTDLLSDEEQFSIWFSKDNDQVRFQASFKAGVQIAYPDLVVDFKLT* |
| Ga0099850_12753862 | 3300007960 | Aqueous | LLSDEEQFSIWHSKDNDQVRFQASFKCGVNFAYGDLIVDWKLA* |
| Ga0105746_10079481 | 3300007973 | Estuary Water | DLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT* |
| Ga0105747_10183141 | 3300007974 | Estuary Water | SYLGNFFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT* |
| Ga0108970_112327832 | 3300008055 | Estuary | LWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFKLA* |
| Ga0114350_11892241 | 3300008116 | Freshwater, Plankton | VPGLTGTNRIVSSYLGNFFYGTDLLSDEEQFSIWFSKDNDQVRFQASFKCGVQLAWPDLVVDFRLT* |
| Ga0114353_13979051 | 3300008264 | Freshwater, Plankton | YLGNMFYGTDLLSDEEQFSIWHSRDNDEIRFQAAMKAGVQIAYPEFVVDWKLA* |
| Ga0114361_10756861 | 3300008265 | Freshwater, Plankton | QFSIFYARENDEVRSIAAFKAGVQMAYPDLVVDFRLA* |
| Ga0114878_10148385 | 3300008339 | Freshwater Lake | EQFSIWHSRDNDEIRFQAAMKAGVQIAYPEFVVDWKLA* |
| Ga0110928_10355873 | 3300008510 | Water Bodies | LFYGTDLLTDEENFELWYSKDNDEVRFQASFKVGVQVAYPDLVVDFRLA* |
| Ga0105098_103961841 | 3300009081 | Freshwater Sediment | LSNLFYGTDLLSDEEQFSIWHSRDNDEVRLQAAFKAGVQFAYPEFIVDWKLA* |
| Ga0105102_106238841 | 3300009165 | Freshwater Sediment | TDLLSDEEQFSIWHSRDNDEVRFQAAFKAGVQFAYPEFIVDWKLA* |
| Ga0129333_101492201 | 3300010354 | Freshwater To Marine Saline Gradient | LGNFFYGTDLLSDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDWRLA* |
| Ga0129333_103095171 | 3300010354 | Freshwater To Marine Saline Gradient | DLLSDEEQFSIWHSKDQDEVRFQASFKASTQIAYPEFVVDFRLA* |
| Ga0129333_116461781 | 3300010354 | Freshwater To Marine Saline Gradient | DLLSDEEQFSIFYARENDEIRSIAAFKAGVQIAYPEFVVDFKLA* |
| Ga0129324_103610531 | 3300010368 | Freshwater To Marine Saline Gradient | SDEEQFSIFYARENDEIRSIAAFKAGVQIAYPDLVVDFKLA* |
| Ga0153805_10620661 | 3300012013 | Surface Ice | LGNFFYGTDLLSDEEQFSIWFSKDNDQVRFQASFKCGVQLAWPDLVVDFRLT* |
| Ga0157605_12140391 | 3300012716 | Freshwater | GTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFKLT* |
| Ga0157625_11987151 | 3300012729 | Freshwater | RIVASYLGNFHLGTDLLSDEEQFSIFYSRDNDEVRSIAAFKAGVQIAYPDLVVDFRLT* |
| Ga0157628_11300581 | 3300012757 | Freshwater | IVSSYLGNFFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLIVDFRLT* |
| Ga0164306_110885682 | 3300012988 | Soil | FEMYYSKDNDEVRFWAEFKMGVNVVLPDEVVEFTLAA* |
| Ga0164293_101294733 | 3300013004 | Freshwater | FSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT* |
| Ga0157618_11049541 | 3300013074 | Freshwater | SYLGNFFYGTDLLSDEEQFSIFYSRDLDEVRSIAAFKAGVQIAYPDLVVDFRLT* |
| (restricted) Ga0172367_105590641 | 3300013126 | Freshwater | SYLGNFFYGTDLLSDEERFELFWSRDNDEVRFQASLKCGVQTAYPDLVVDWKLA* |
| (restricted) Ga0172367_107286562 | 3300013126 | Freshwater | DEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFKLA* |
| (restricted) Ga0172363_107994061 | 3300013130 | Sediment | LLSDEEQFSIWHSRDNDEIRFQAALKAGVQIAYPEFVVNWQLA* |
| (restricted) Ga0172372_104202823 | 3300013132 | Freshwater | FFYGTDLLSDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFKLA* |
| (restricted) Ga0172362_106604581 | 3300013133 | Sediment | DLLSDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFKLA* |
| (restricted) Ga0172375_105486562 | 3300013137 | Freshwater | ENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFKLA* |
| Ga0170791_109962721 | 3300013295 | Freshwater | SDEEQFSIWFSKDNDEVRFQAAFKAGVQFAYPDLIVDFRLT* |
| Ga0181358_11723711 | 3300017774 | Freshwater Lake | NFFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLIVDFRLT |
| Ga0181357_12879242 | 3300017777 | Freshwater Lake | ELWYSKDNDEVRFQAAFKAGVQFAYPDLMVDFKLA |
| Ga0181355_11299081 | 3300017785 | Freshwater Lake | SIFYSRDLDEVRSIAAFKAGVQIAYPDLVVDFRLT |
| Ga0194111_107749251 | 3300020083 | Freshwater Lake | FYGTDLLSDEEQFSIFYSRDNDEVRFQASFKAGVQVAYPDLIVDFKLA |
| Ga0194110_102256053 | 3300020084 | Freshwater Lake | TDLLSDEEQFSIFYSRDNDEVRFQASFKAGVQVAYPDLIVDFKLA |
| Ga0194115_103666971 | 3300020183 | Freshwater Lake | QFSIFYSRDNDEVRFQASFKAGVQVAYPDLIVDFKLA |
| Ga0194120_103335061 | 3300020198 | Freshwater Lake | LTTNRIVCTYLGNLFYGTDLLSDEEQFSIFYSRDNDEVRFQASFKAGVQVAYPDLIVDFKLA |
| Ga0208465_100097210 | 3300020570 | Freshwater | YATDLLSDEEQFSIFYARENDEIRSIAAFKAGVQIAWPDLVVDFRLT |
| Ga0208723_10401151 | 3300020571 | Freshwater | VCTYLGNLFYGTDLLSDEENFSLWYSQDNDEVRFQAAFKAGVQFAYPDLMVDFRLA |
| Ga0194129_102849063 | 3300020578 | Freshwater Lake | VCTYLGNLFVGVDLLSDEDNISVWHSKDNDSIRVQASFRLGVQTAYPDLIVDFKLA |
| Ga0194123_101824741 | 3300021093 | Freshwater Lake | VCTYLGNLFYGTDLLSDEEQFSIFYSRDNDEVRFQASFKAGVQVAYPDLIVDFKLA |
| Ga0222714_106419501 | 3300021961 | Estuarine Water | LFYGTDLLSDEEQFSIWLSRDNDSIRWQAAFKAGVNFAYPDLMVDFRLA |
| Ga0222713_101356581 | 3300021962 | Estuarine Water | GTDLLSDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFRLA |
| Ga0222712_101071563 | 3300021963 | Estuarine Water | NFFYGTDLLSDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLMVDFRLA |
| Ga0228702_10237331 | 3300022748 | Freshwater | FYGTDLLSDEEQFSIWLSRDNDSIRYQAAFKAGVNFAYPDLMVDFKLA |
| Ga0255187_10547522 | 3300024510 | Freshwater | RIVATYLGNLFYGTDLLSDEEQFSIWLSRDNDSIRYQAAFKAGVNFAYPDLMVDFRLA |
| Ga0255186_10425131 | 3300024512 | Freshwater | LFYGTDLLSDEEQFSIWVSRDNDSIRYQAAFKAGVQFAYPDLIVDWKLA |
| Ga0256302_10817171 | 3300024571 | Freshwater | ATYLGNLFYGTDLLSDEENFELWYSKDNDEVRFQAAFKAGVQFAYPDLMVDFRLA |
| Ga0208004_11156551 | 3300025630 | Aqueous | SDEEQFSIWHSRDNDEVRFQAAFKAGVQFAYPEFIVDWKLA |
| Ga0208644_11903171 | 3300025889 | Aqueous | DEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFRLA |
| Ga0208027_10672481 | 3300027260 | Estuarine | FFYGTDLLSDEDQFNMWYSQDNDEVRFMAAFKMGVQMAYPDLVVQFRLATS |
| Ga0208440_10666181 | 3300027281 | Estuarine | NRMVCSYLGNFFYGTDLLSDEEQFSIWPSIDNDEIRFQCALKCGVQVAYPDLVVDWRLA |
| Ga0208441_10642352 | 3300027294 | Estuarine | VCSYLGNFFYGTDLLSDEEQFSIWPSIDNDEIRFQCALKCGVQVAYPDLVVDWRLA |
| Ga0208810_10380703 | 3300027304 | Estuarine | PGLTNTNRIVCTYLGNLVYATDLLSDEEQFSIFYARENDEVRSIAAFKAGVQIAYPDFVVDFRLA |
| Ga0255093_10599672 | 3300027492 | Freshwater | FYGTDLLSDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFKLA |
| Ga0208974_11159711 | 3300027608 | Freshwater Lentic | FFYGTDLLSDEENFSLWYSQDNDEVRFQAAFKVGVQVAYPDLIVDWRLA |
| Ga0209353_100745863 | 3300027798 | Freshwater Lake | CSYLGNFFYATDLLSDEENFSLWYSQDNDEVRFQAAFKVGVQVAYPDLIVDWKLA |
| Ga0209298_103465792 | 3300027973 | Freshwater Lake | LFYASDLLSDEEQFSIFYARENDEIRSIAAFKAGVQFAYPDLIVDFRLA |
| Ga0119944_10159123 | 3300029930 | Aquatic | IVTSYLGNMFYGTDLLSDEEQFSIWHSRDNDEIRFQAAMKAGVQIAYPEFVVDWKLA |
| Ga0315904_102097893 | 3300031951 | Freshwater | GTDLLSDEEQFSIWPSIDNDEIRFQCALKCGVQVAYPDLVVDWRLA |
| Ga0315904_111810222 | 3300031951 | Freshwater | DEENFSLWYSQDNDEVRFQAAFKAGVQFAYPDLMVDFRLA |
| Ga0315906_102736013 | 3300032050 | Freshwater | STNRIVCTYLGNLFYGTDLLSDEENFSLWYSQDNDEVRFQAAFKAGVQFAYPDLMVDFKL |
| Ga0315906_110148651 | 3300032050 | Freshwater | DEENFSLWYSQDNDEVRFQAAFKAGVQFAYPDLIVDWKLA |
| Ga0315905_1000092649 | 3300032092 | Freshwater | NFELWYSKDNDEVRFQAAFKAGVQFAYPDLMVDFKLA |
| Ga0315903_102966031 | 3300032116 | Freshwater | TDLLSDEENFSLWYSQDNDEVRFQAAFKAGVQFAYPDLMVDFKLA |
| Ga0334982_0178333_943_1062 | 3300033981 | Freshwater | EEQFSIWPSIDNDEIRFQCALKIGVNIAYPDLVVDWRLA |
| Ga0334986_0598861_385_516 | 3300034012 | Freshwater | LLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLIVDFRLT |
| Ga0335021_0652292_1_174 | 3300034023 | Freshwater | IVSSYLGNFFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT |
| Ga0334987_0123994_1_114 | 3300034061 | Freshwater | QFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT |
| Ga0334987_0359111_17_148 | 3300034061 | Freshwater | LLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT |
| Ga0334995_0649180_1_153 | 3300034062 | Freshwater | NFFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFKLT |
| Ga0310130_0016703_2240_2389 | 3300034073 | Fracking Water | LFYGTDLLSDEEQFSIWFSRDNDEVRFQAAFKAGVQFAYPDLIVDWKLA |
| Ga0335014_0123238_1_126 | 3300034094 | Freshwater | SDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT |
| Ga0335027_0382553_1_168 | 3300034101 | Freshwater | SSYLGNFFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT |
| Ga0335027_0495275_628_759 | 3300034101 | Freshwater | LLSDEENFSLWYSQDNDEVRFQAAFKAGVQFAYPDLIVDWRLA |
| Ga0335027_0507729_15_146 | 3300034101 | Freshwater | LLSDEENFSLWYSQDNDEVRFQAAFKAGVQFAYPDLMVDFRLA |
| Ga0335036_0472189_674_787 | 3300034106 | Freshwater | QFSIFYSRDNDEVRSIAAFKCGVQLAWPDLVVDFKLT |
| Ga0335063_0342863_651_773 | 3300034111 | Freshwater | DEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT |
| Ga0335066_0324754_754_861 | 3300034112 | Freshwater | SIWPSIDNDEIRFQCALKIGVNIAYPDLVVDWRLA |
| Ga0335054_0478344_532_663 | 3300034119 | Freshwater | LLSDEENFELWYSKDNDEVRFQAAFKAGVQFAYPDLMVDFRLA |
| Ga0335060_0133755_2_178 | 3300034122 | Freshwater | RIVASYLGNFHLGTDLLSDEEQFSIFYSRDNDEVRSIAAFKCGVQLAWPDLVVDFRLT |
| ⦗Top⦘ |