


| Basic Information | |
|---|---|
| Family ID | F096818 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 46 residues |
| Representative Sequence | RAAANRTTYPTGWPPFGATEPRTWGPSRMIYWAKIGFEKWWLWRYF |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 84.62 % |
| % of genes from short scaffolds (< 2000 bps) | 83.65 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (9.615 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (29.808 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.32% β-sheet: 0.00% Coil/Unstructured: 75.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF07992 | Pyr_redox_2 | 6.73 |
| PF09976 | TPR_21 | 5.77 |
| PF13432 | TPR_16 | 4.81 |
| PF00890 | FAD_binding_2 | 3.85 |
| PF02190 | LON_substr_bdg | 3.85 |
| PF00701 | DHDPS | 3.85 |
| PF02577 | BFN_dom | 3.85 |
| PF13174 | TPR_6 | 2.88 |
| PF03401 | TctC | 1.92 |
| PF04199 | Cyclase | 1.92 |
| PF04055 | Radical_SAM | 1.92 |
| PF02597 | ThiS | 1.92 |
| PF07728 | AAA_5 | 0.96 |
| PF04273 | BLH_phosphatase | 0.96 |
| PF13429 | TPR_15 | 0.96 |
| PF02826 | 2-Hacid_dh_C | 0.96 |
| PF02780 | Transketolase_C | 0.96 |
| PF01807 | zf-CHC2 | 0.96 |
| PF13175 | AAA_15 | 0.96 |
| PF06577 | EipA | 0.96 |
| PF13428 | TPR_14 | 0.96 |
| PF00753 | Lactamase_B | 0.96 |
| PF13676 | TIR_2 | 0.96 |
| PF01977 | UbiD | 0.96 |
| PF03928 | HbpS-like | 0.96 |
| PF07366 | SnoaL | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 7.69 |
| COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 3.85 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 1.92 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 1.92 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 1.92 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.92 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.96 |
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.96 |
| COG3453 | Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 family | General function prediction only [R] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.50 % |
| Unclassified | root | N/A | 37.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2084038009|LWFCA_GLZZ6Z001BAB4D | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 2088090009|LWAnN_GIDYKCY01BMO3S | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300000205|NICFPass4XylDRAFT_c026922 | Not Available | 772 | Open in IMG/M |
| 3300000891|JGI10214J12806_12946728 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300000956|JGI10216J12902_122123046 | Not Available | 541 | Open in IMG/M |
| 3300001781|Deep_1051506 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300001840|shallow_1071031 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300002121|C687J26615_10097969 | Not Available | 735 | Open in IMG/M |
| 3300002124|C687J26631_10047387 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300002147|JGI24793J26633_1026591 | Not Available | 1229 | Open in IMG/M |
| 3300002529|C687J35504_10088301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_55_13 | 1398 | Open in IMG/M |
| 3300002558|JGI25385J37094_10193139 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300002561|JGI25384J37096_10181105 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300002908|JGI25382J43887_10134469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1273 | Open in IMG/M |
| 3300003319|soilL2_10184924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3937 | Open in IMG/M |
| 3300003702|PicMicro_10002430 | All Organisms → cellular organisms → Bacteria | 22514 | Open in IMG/M |
| 3300004480|Ga0062592_101264269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 694 | Open in IMG/M |
| 3300004779|Ga0062380_10258162 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300004782|Ga0062382_10245012 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005093|Ga0062594_101129763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 769 | Open in IMG/M |
| 3300005180|Ga0066685_11073074 | Not Available | 528 | Open in IMG/M |
| 3300005339|Ga0070660_100047813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3284 | Open in IMG/M |
| 3300005366|Ga0070659_102102519 | Not Available | 507 | Open in IMG/M |
| 3300005529|Ga0070741_10000016 | All Organisms → cellular organisms → Bacteria | 625103 | Open in IMG/M |
| 3300005713|Ga0066905_101437881 | Not Available | 625 | Open in IMG/M |
| 3300005764|Ga0066903_104961320 | Not Available | 706 | Open in IMG/M |
| 3300005830|Ga0074473_11183804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1000 | Open in IMG/M |
| 3300006031|Ga0066651_10342471 | Not Available | 802 | Open in IMG/M |
| 3300006845|Ga0075421_100035343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6327 | Open in IMG/M |
| 3300006847|Ga0075431_100139878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2495 | Open in IMG/M |
| 3300006852|Ga0075433_10265361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1522 | Open in IMG/M |
| 3300006854|Ga0075425_100559727 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300006865|Ga0073934_10000656 | All Organisms → cellular organisms → Bacteria | 96312 | Open in IMG/M |
| 3300009087|Ga0105107_11026277 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300009157|Ga0105092_10493982 | Not Available | 701 | Open in IMG/M |
| 3300009157|Ga0105092_10732128 | Not Available | 577 | Open in IMG/M |
| 3300009162|Ga0075423_10173359 | Not Available | 2265 | Open in IMG/M |
| 3300009162|Ga0075423_10313698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1644 | Open in IMG/M |
| 3300009162|Ga0075423_10605904 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300009444|Ga0114945_10074917 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
| 3300009514|Ga0129284_10209133 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300009609|Ga0105347_1309347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300009786|Ga0114999_10837112 | Not Available | 677 | Open in IMG/M |
| 3300010323|Ga0134086_10173170 | Not Available | 796 | Open in IMG/M |
| 3300010359|Ga0126376_12206468 | Not Available | 596 | Open in IMG/M |
| 3300010360|Ga0126372_10950267 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300010361|Ga0126378_11200131 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria → unclassified Candidatus Poribacteria → Candidatus Poribacteria bacterium | 857 | Open in IMG/M |
| 3300010361|Ga0126378_12318149 | Not Available | 613 | Open in IMG/M |
| 3300010362|Ga0126377_10635076 | Not Available | 1115 | Open in IMG/M |
| 3300010366|Ga0126379_11991514 | Not Available | 683 | Open in IMG/M |
| 3300010376|Ga0126381_102386018 | Not Available | 759 | Open in IMG/M |
| 3300010376|Ga0126381_104111134 | Not Available | 565 | Open in IMG/M |
| 3300010397|Ga0134124_12945048 | Not Available | 520 | Open in IMG/M |
| 3300010398|Ga0126383_10104770 | All Organisms → cellular organisms → Bacteria | 2537 | Open in IMG/M |
| 3300010401|Ga0134121_11135395 | Not Available | 777 | Open in IMG/M |
| 3300012179|Ga0137334_1040321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 971 | Open in IMG/M |
| 3300012179|Ga0137334_1060792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 816 | Open in IMG/M |
| 3300012356|Ga0137371_10840822 | Not Available | 699 | Open in IMG/M |
| 3300012361|Ga0137360_10568918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 969 | Open in IMG/M |
| 3300012971|Ga0126369_13225648 | Not Available | 534 | Open in IMG/M |
| 3300013296|Ga0157374_12245279 | Not Available | 573 | Open in IMG/M |
| 3300013306|Ga0163162_13065776 | Not Available | 537 | Open in IMG/M |
| 3300014745|Ga0157377_10093328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1781 | Open in IMG/M |
| 3300015372|Ga0132256_101620605 | Not Available | 757 | Open in IMG/M |
| 3300015372|Ga0132256_102427028 | Not Available | 627 | Open in IMG/M |
| 3300015372|Ga0132256_103470934 | Not Available | 530 | Open in IMG/M |
| 3300015373|Ga0132257_100978616 | Not Available | 1064 | Open in IMG/M |
| 3300018031|Ga0184634_10489442 | Not Available | 550 | Open in IMG/M |
| 3300018031|Ga0184634_10510438 | Not Available | 536 | Open in IMG/M |
| 3300018063|Ga0184637_10255142 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300018067|Ga0184611_1073915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1162 | Open in IMG/M |
| 3300018075|Ga0184632_10300052 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300018077|Ga0184633_10187574 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1070 | Open in IMG/M |
| 3300018079|Ga0184627_10503784 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300018082|Ga0184639_10538989 | Not Available | 582 | Open in IMG/M |
| 3300018481|Ga0190271_10879520 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300020022|Ga0193733_1104530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 789 | Open in IMG/M |
| 3300025160|Ga0209109_10120491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19 | 1340 | Open in IMG/M |
| 3300025167|Ga0209642_10158286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1310 | Open in IMG/M |
| 3300025310|Ga0209172_10000953 | All Organisms → cellular organisms → Bacteria | 70096 | Open in IMG/M |
| 3300025311|Ga0209343_10127391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2057 | Open in IMG/M |
| 3300025322|Ga0209641_11120375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300025326|Ga0209342_10098449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2702 | Open in IMG/M |
| 3300025903|Ga0207680_10915333 | Not Available | 628 | Open in IMG/M |
| 3300025910|Ga0207684_11369079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300025920|Ga0207649_11579550 | Not Available | 519 | Open in IMG/M |
| 3300025932|Ga0207690_10346738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1173 | Open in IMG/M |
| 3300026297|Ga0209237_1256972 | Not Available | 536 | Open in IMG/M |
| 3300026334|Ga0209377_1001891 | All Organisms → cellular organisms → Bacteria | 13804 | Open in IMG/M |
| 3300027682|Ga0209971_1020853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1559 | Open in IMG/M |
| 3300027831|Ga0209797_10148658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1008 | Open in IMG/M |
| 3300027909|Ga0209382_10053586 | All Organisms → cellular organisms → Bacteria | 4800 | Open in IMG/M |
| 3300027909|Ga0209382_11062201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 839 | Open in IMG/M |
| 3300027951|Ga0209754_1006420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6096 | Open in IMG/M |
| 3300030606|Ga0299906_11081883 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10062665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 978 | Open in IMG/M |
| 3300031965|Ga0326597_10613029 | Not Available | 1162 | Open in IMG/M |
| 3300032003|Ga0310897_10644680 | Not Available | 527 | Open in IMG/M |
| 3300032163|Ga0315281_12135184 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300032261|Ga0306920_100180372 | All Organisms → cellular organisms → Bacteria | 3150 | Open in IMG/M |
| 3300032278|Ga0310345_10607371 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300033412|Ga0310810_10185886 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2368 | Open in IMG/M |
| 3300033414|Ga0316619_11365770 | Not Available | 631 | Open in IMG/M |
| 3300034820|Ga0373959_0095324 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.62% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.65% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.85% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.88% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.88% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 2.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 1.92% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 1.92% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
| Host-Associated | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.96% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.96% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.96% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.96% |
| Marine, Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine, Hydrothermal Vent Plume | 0.96% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.96% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.96% |
| Beach Aquifer Porewater | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Feedstock Adapted Compost | Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2084038009 | Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - from flow sorted aerobic no nitrate | Environmental | Open in IMG/M |
| 2088090009 | Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrate | Environmental | Open in IMG/M |
| 3300000205 | Feedstock adapted compost microbial communities from Newby Island compost facility, Milpitas, CA, USA - Passage 4_Xylan | Engineered | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001781 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Deep Sites | Environmental | Open in IMG/M |
| 3300001840 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Shallow Sites - gte1kb - lt4kb | Environmental | Open in IMG/M |
| 3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
| 3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
| 3300002147 | Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by freeze-thaw cycling | Host-Associated | Open in IMG/M |
| 3300002529 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank highO2_0.2 | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003702 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Microbial Assembly | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009514 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - F-1W | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027951 | Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by bead beating (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LWFCA_05592620 | 2084038009 | Freshwater Sediment | LACGAGRAAANRTTYPTGWPPFGVTDPRTLGPSKLIYWAKIGFEKWWLWR |
| LWAnN_04095750 | 2088090009 | Freshwater Sediment | AANRTTYPTGWPPFGVTDPRTLGPSKLIYWAKIGFEKWWLWRYF |
| NICFPass4XylDRAFT_0269222 | 3300000205 | Feedstock Adapted Compost | LLAYGAGSAAANRTIYPRGWPPHGTGVSRSWGPSPLLYWAKVGFEKWWLWRYF |
| JGI10214J12806_129467281 | 3300000891 | Soil | GWPPFGVTDPRTWGPNRAIYWAKVGFEKWWLWRYF* |
| JGI10216J12902_1221230461 | 3300000956 | Soil | AFGAGRAAANRTTYPTGWPPFGVTDPRTLGPSKLIYWAKIGFEKWWLWRYF* |
| Deep_10515061 | 3300001781 | Hydrothermal Vent Plume | YGAGRAAANRTIYPTGWPPYGAGTSKVWGPSRLVYGAKIAFEKWWLWRYF* |
| shallow_10710312 | 3300001840 | Hydrothermal Vent Plume | LVAYGAGRAAANRTIYPTGWPPYGGGTSKVWGPSRLVYGAKIAFEKWWLWRYF* |
| C687J26615_100979693 | 3300002121 | Soil | GRAAANRTTYPQGWPPFGTTEPRTWGPSRSIYWAKIAFEKWWLWRYF* |
| C687J26631_100473873 | 3300002124 | Soil | GWPPFGVTEPRTWGPSRLIYWAKIGFEKWWLWRYF* |
| JGI24793J26633_10265912 | 3300002147 | Host-Associated | ANRTTYPQGWPPFGATDSRSWGPSRTIYWSKVLFEKWWLWRYF* |
| C687J35504_100883011 | 3300002529 | Soil | AGRAAANRTIYPRGWPTFGATEARTWGPSRSIYWAKILFEKWWLWRYF* |
| JGI25385J37094_101931391 | 3300002558 | Grasslands Soil | PPYDMLLAYGAGRAAANRTIYPQGWPPFGATDARTWGPSRWIYWAKVGFEKWWLWRYF* |
| JGI25384J37096_101811052 | 3300002561 | Grasslands Soil | YGAGRAAANRTIYPQGWPPFGATDARTWGPSRWIYWAKVGFEKWWLWRYF* |
| JGI25382J43887_101344691 | 3300002908 | Grasslands Soil | IYPQGWPPFGATDARTWGPSRWIYWAKVGFEKWWLWRYF* |
| soilL2_101849247 | 3300003319 | Sugarcane Root And Bulk Soil | MNRTIYPQGWPPFAPSYARTWGPSPFIYWAKVMFEKWWLWRYF* |
| PicMicro_1000243017 | 3300003702 | Marine, Hydrothermal Vent Plume | VAYGAGRAAANRTIYPTGWPPYGAGTSKVWGPSRLVYGAKIAFEKWWLWRYF* |
| Ga0062592_1012642692 | 3300004480 | Soil | NRTTYPTGWPPFGATDPRTLGPSRLIYWAKLGFEKWWLWRYF* |
| Ga0062380_102581622 | 3300004779 | Wetland Sediment | RTTYPTSWPPFGVTDPRTWGPNKAIYWAKIGFEKWWLWRYF* |
| Ga0062382_102450123 | 3300004782 | Wetland Sediment | HHMTLAYGAGRAAANRTTYPTGWPPFGVTDPRTWGPNKAIYWAKLGFEKWWLWRYF* |
| Ga0062594_1011297631 | 3300005093 | Soil | LAFGAGRAAANRTTYPTGWPPYGVTDPRTWGPSRMIYWAKIGFEKWWLWRYF* |
| Ga0066685_110730742 | 3300005180 | Soil | ANRTTYPNGWPPFGTGSSRTWGPSPLIYLAKLGFEKWWLWRYF* |
| Ga0070660_1000478135 | 3300005339 | Corn Rhizosphere | NRTTYPTGWPPFGVTEPRTWGPSRMIYWAKIGFEKWWLWRYF* |
| Ga0070659_1021025191 | 3300005366 | Corn Rhizosphere | GAGRAAANRTTYPTGWPPFGVTEPRTWGPSRMIYWAKIGFEKWWLWRYF* |
| Ga0070741_10000016404 | 3300005529 | Surface Soil | MNRTIYPSGWPPFAATEARTWGPSPFIYWAKIGFEKWWLWRYF* |
| Ga0066905_1014378811 | 3300005713 | Tropical Forest Soil | GRAAANRTTYPTGWPAFGATESRTWGPSRLIYWAKLGFEKWWLWRYF* |
| Ga0066903_1049613203 | 3300005764 | Tropical Forest Soil | AIRTIYPTSWPPFGVTEPRAWGPSRLIYWAKVGFEKWWLWRYF* |
| Ga0074473_111838041 | 3300005830 | Sediment (Intertidal) | PTGWPPFGATEPRTWGPSRSMYWAKIAFEKWWLWRFF* |
| Ga0066651_103424713 | 3300006031 | Soil | AMNRTIYPRGWPPFAPTDARTWGPSPFIYWAKILFEKWWLWRYF* |
| Ga0075421_1000353436 | 3300006845 | Populus Rhizosphere | LAFGAGRAAANRTIYPSGWPPFGATEARTWGPSKLIYWAKLGFEKWWLWRYF* |
| Ga0075431_1001398781 | 3300006847 | Populus Rhizosphere | AFGAGRAAANRTIYPSGWPPFGATEARTWGPSKLIYWAKLGFEKWWLWRYF* |
| Ga0075433_102653611 | 3300006852 | Populus Rhizosphere | YPTGWPPFGATEPRTWGPSRMIYWAKVGFEKWWLWRYF* |
| Ga0075425_1005597274 | 3300006854 | Populus Rhizosphere | MNRTIYPSGWPPFAATEARTWGPSPFIYWAKVGFEKWWLWRYF* |
| Ga0073934_1000065618 | 3300006865 | Hot Spring Sediment | LAFGAGRAAANRTTYPTGWPPFGVTDPRTIGPSKLIYWAKIGFEKWWLWRYF* |
| Ga0105107_110262772 | 3300009087 | Freshwater Sediment | YGAGRAAANRTTYPTGWPPFGITDPRTWGPNKAIYWAKIGFEKWWLWRYF* |
| Ga0105092_104939821 | 3300009157 | Freshwater Sediment | TVYPTGWPPLGVTEPRTWGPSRLIYWAKIGFEKWWLWRYF* |
| Ga0105092_107321282 | 3300009157 | Freshwater Sediment | ADRAAAIRTIDPAGWPPFGITEPLTGGPSRLIYWAKIGFEKWWLWRYF* |
| Ga0075423_101733591 | 3300009162 | Populus Rhizosphere | GRAAMNRTIYPSGWPPFAATEARTWGPSPFIYWAKVGFEKWWLWRYF* |
| Ga0075423_103136983 | 3300009162 | Populus Rhizosphere | LLAFGAGRAAANRTVYPTGWPPFGVTDSRTWGPSRLIYWAKIGFEKWWLWRYF* |
| Ga0075423_106059042 | 3300009162 | Populus Rhizosphere | MLAFGAGRAAANRTVYPTGWPPFGVTEPRTWGPSRLIYWAKVGFEKWWLWRYF* |
| Ga0114945_100749173 | 3300009444 | Thermal Springs | LLAYGAGRAAANRTVYPRGWPPFGTGEARSWGPSRLIYWAKIGFEKWWLWRYF* |
| Ga0129284_102091331 | 3300009514 | Beach Aquifer Porewater | GAGRAAANRTTYPTGWPPFGVTEARTWGPSRLIYWAKLGFEKWWLWRYF* |
| Ga0105347_13093472 | 3300009609 | Soil | LAFGAGRAAANRTTYPTGWPPFGVTDPKTLGPSKVIYWAKIGFEKWWLWRYF* |
| Ga0114999_108371122 | 3300009786 | Marine | THGAGRASANRTTYPAGWPPFGKPESRAWGPSQLIYGAKIGFEKWWLWRYF* |
| Ga0134086_101731701 | 3300010323 | Grasslands Soil | RTVYPTGWPPFGVTEPKTWGPSRLIYWAKIGFEKWWLWRYF* |
| Ga0126376_122064682 | 3300010359 | Tropical Forest Soil | RAAANRTIYPTGWPPFGATEPRTWGPSRLIYWAKVGFEKWWLWRYF* |
| Ga0126372_109502672 | 3300010360 | Tropical Forest Soil | MNRTIYPQGWPPFAPTDARTWGPSPFIYWAKVLFEKWWLWRYF* |
| Ga0126378_112001311 | 3300010361 | Tropical Forest Soil | WPPFGVTEPQAWGPSRFIYWAKIGFEKWWLWRYF* |
| Ga0126378_123181492 | 3300010361 | Tropical Forest Soil | FGAGRAAANRTTYPTGWPPFGATEPRTWGPSRLIYWAKIGFEKWWLWRYF* |
| Ga0126377_106350763 | 3300010362 | Tropical Forest Soil | TIYPTGWPPFGATEPRTWGPSRLIYWAKIGFEKWWLWRYF* |
| Ga0126379_119915141 | 3300010366 | Tropical Forest Soil | AAIRTIYPTSWPPFGVTEPRAWGPSRFIYWAKIGFEKWWLWRYF* |
| Ga0126381_1023860183 | 3300010376 | Tropical Forest Soil | AAAIRTIYPTSWPPFGVTEPRAWGPSRFIYWAKIGFEKWWLWRYF* |
| Ga0126381_1041111342 | 3300010376 | Tropical Forest Soil | GRAAAIRTIYPTSWPPFGVTEPRAWGPSRLIYWAKVGFEKWWLWRYF* |
| Ga0134124_129450481 | 3300010397 | Terrestrial Soil | AANRTTYPTGWPPYGVTDPRTWGPSRMIYWAKIGFEKWWLWRYF* |
| Ga0126383_101047701 | 3300010398 | Tropical Forest Soil | LAYGAGRAAAIRTIYPTSWPPFGVTEPRAWGPSRLIYWAKVGFEKWWLWRYF* |
| Ga0134121_111353951 | 3300010401 | Terrestrial Soil | GAGRAAMNRTIYPQGWPNFAPSYARTWGPSPFIYWAKVLFEKWWLWRYF* |
| Ga0137334_10403212 | 3300012179 | Soil | ANRTVYPTGWPSFGVADPRTWGPSRLIYWAKIAFEKWWLWRYF* |
| Ga0137334_10607921 | 3300012179 | Soil | GWPPFGVTEPRTWGPSRVIYWAKIGFEKWWLWRYF* |
| Ga0137371_108408221 | 3300012356 | Vadose Zone Soil | AAANRTVYPTGWPPFGVTEPKTWGPSRLIYWAKIGFEKWWLWRYF* |
| Ga0137360_105689181 | 3300012361 | Vadose Zone Soil | RAAANRTTYPTGWPPFGATEPRTWGPSRMIYWAKIGFEKWWLWRYF* |
| Ga0126369_132256482 | 3300012971 | Tropical Forest Soil | AFGAGRAAANRNTYPTGWPPFGATEPRTWGPSRLIYWAKIGFEKWWLWRYF* |
| Ga0157374_122452791 | 3300013296 | Miscanthus Rhizosphere | GRAAANRTTYPTGWPPFGATEPRTWGPSRMIYWAKIGFEKWWLWRYF* |
| Ga0163162_130657762 | 3300013306 | Switchgrass Rhizosphere | AGRAAANRTTYPTGWPPYGVTDPRTWGPSRMIYWAKIGFEKWWLWRYF* |
| Ga0157377_100933281 | 3300014745 | Miscanthus Rhizosphere | AAANRTIYPTGWPPFGVTDPRTWGPNRAIYWAKIGFEKWWLWRYF* |
| Ga0132256_1016206051 | 3300015372 | Arabidopsis Rhizosphere | ANRTTYPTGWPPFGVTEPRTWGPSRMIYWAKVGFEKWWLWRYF* |
| Ga0132256_1024270281 | 3300015372 | Arabidopsis Rhizosphere | PTGWPPFGAIEPRSWGPSRMIYWAKVGFEKWWLWRYF* |
| Ga0132256_1034709342 | 3300015372 | Arabidopsis Rhizosphere | RTTYPTGWPPFGVTEPRTWGPSRMIYWAKVGFEKWWLWRYF* |
| Ga0132257_1009786161 | 3300015373 | Arabidopsis Rhizosphere | LAFGAGRAAANRTTYPTGWPPFGATEPRTWGPSRMIYWAKVGFEKWWLWRYF* |
| Ga0184634_104894421 | 3300018031 | Groundwater Sediment | LLAYGAGRAAANRTVYPGGWPPFGAGEARSWGPNRLIYWAKIGFEKWWLWRYF |
| Ga0184634_105104382 | 3300018031 | Groundwater Sediment | GRAAANRTVYPRGWPPFGAGEARSWDPNRLIYWAKIGFEKWWLWRYF |
| Ga0184637_102551422 | 3300018063 | Groundwater Sediment | LAFGAGRAAANRTTYPNGWPPFGSGSSRSWGPSPLIYLAKVAFEKWWLWRYF |
| Ga0184611_10739151 | 3300018067 | Groundwater Sediment | RTTYPTGWPPFGATEPRTWGPSRMIYWAKVGFEKWWLWRYF |
| Ga0184632_103000522 | 3300018075 | Groundwater Sediment | AGRAAANRTTYPTGWPPFGVTDPRTWGPSRLIYWAKVGFEKWWLWRYF |
| Ga0184633_101875741 | 3300018077 | Groundwater Sediment | TYPTGWPPFGVTEARTWGPSRLIYWAKAGFEKWWLWRYF |
| Ga0184627_105037842 | 3300018079 | Groundwater Sediment | RAAANRTTYPTGWPPFGVTEARTWGPSRLIYLAKISFEKWWLWRYF |
| Ga0184639_105389892 | 3300018082 | Groundwater Sediment | GAGRAAVNRTTYPTGWPPFGVTDPRTWGPSRLIYWAKVGFEKWWLWRYF |
| Ga0190271_108795202 | 3300018481 | Soil | FGAGRAAANRTTYPTGWPPFGVTDPRTWGPSRAIYWAKVGFEKWWLWRYF |
| Ga0193733_11045302 | 3300020022 | Soil | TTYPTGWPPFGATEPRTWGPSRMIYWAKIGFEKWWLWRYF |
| Ga0209109_101204911 | 3300025160 | Soil | RTIYPRGWPPFGATEARTWGPSKAIYWAKVAFEKWWLWRYF |
| Ga0209642_101582861 | 3300025167 | Soil | YPTGWPPFGVTEPRTWGPSRLIYWAKIGFEKWWLWRYF |
| Ga0209172_1000095325 | 3300025310 | Hot Spring Sediment | LAFGAGRAAANRTTYPTGWPPFGVTDPRTIGPSKLIYWAKIGFEKWWLWRYF |
| Ga0209343_101273914 | 3300025311 | Groundwater | ANRTIYPTGWPPFGVTEARTWGPSRLIYWAKIGFEKWWLWRYF |
| Ga0209641_111203751 | 3300025322 | Soil | PRSWPPFGETEPRTWGPSRMLYWAKIAFEKWWLWRYF |
| Ga0209342_100984491 | 3300025326 | Soil | TVYPTGWPPFGVTEPRTWGPSRLIYWAKIGFEKWWLWRYF |
| Ga0207680_109153331 | 3300025903 | Switchgrass Rhizosphere | GWPPFGVTEPRTWGPSRMIYWAKIGFEKWWLWRYF |
| Ga0207684_113690791 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GWPPFGATEPRTWGPSRMIYWAKIGFEKWWLWRYF |
| Ga0207649_115795502 | 3300025920 | Corn Rhizosphere | AFGAGRAAANRTTYPTGWPPFGVTEPRTWGPSRMIYWAKIGFEKWWLWRYF |
| Ga0207690_103467381 | 3300025932 | Corn Rhizosphere | NRTTYPTGWPPFGVTEPRTWGPSRMIYWAKIGFEKWWLWRYF |
| Ga0209237_12569721 | 3300026297 | Grasslands Soil | GAGRAAANRTVYPTGWPPFGVTEPRTWGPSRLIYWAKIGFEKWWLWRYF |
| Ga0209377_10018911 | 3300026334 | Soil | PTGWPPFGVTEPRTWGPSRLIYWAKIGFEKWWLWRYF |
| Ga0209971_10208531 | 3300027682 | Arabidopsis Thaliana Rhizosphere | SFGAGRAAANRTIYPTGWPPFGVTEARTWGPSKLIYWSKIGFEKWWLWRYF |
| Ga0209797_101486581 | 3300027831 | Wetland Sediment | YPTSWPPFGVTDPRTWGPNKAIYWAKIGFEKWWLWRYF |
| Ga0209382_100535864 | 3300027909 | Populus Rhizosphere | LAFGAGRAAANRTIYPSGWPPFGATEARTWGPSKLIYWAKLGFEKWWLWRYF |
| Ga0209382_110622011 | 3300027909 | Populus Rhizosphere | LLAFGAGRAAANRTTYPTGWPPFGVTEPRTLGPSRLIYWAKVGFEKWWLWRYF |
| Ga0209754_10064208 | 3300027951 | Host-Associated | NRTTYPQGWPPFGATDSRSWGPSRTIYWSKVLFEKWWLWRYF |
| Ga0299906_110818831 | 3300030606 | Soil | LLAFGAGRAAANRTIYPAGWPPFGATEARTWGPSKLIYWAKIGFEKWWLWRYF |
| (restricted) Ga0255310_100626651 | 3300031197 | Sandy Soil | TGWPPFGVTDPRTLGPSKLIYWAKLGFEKWWLWRYF |
| Ga0326597_106130291 | 3300031965 | Soil | LLAFGAGRAAANRTIYPAGWPPFGAAESRAWGPSSLIYLAKIGFEKWWLWRFF |
| Ga0310897_106446801 | 3300032003 | Soil | YPTGWPPYGVTDPRTWGPSRMIYWAKIGFEKWWLWRYF |
| Ga0315281_121351842 | 3300032163 | Sediment | SFGAGRAAANRTTYPNGWPPFGSGSSRSWGPSPLIYLAKIGFEKWWLWRYF |
| Ga0306920_1001803722 | 3300032261 | Soil | MTYPTGWPPFGITEPRTWGPSRMIYWAKIGFEKWWLWRYF |
| Ga0310345_106073712 | 3300032278 | Seawater | VAYGAGRAAANRTIYPTGWPPYGAGTSKVWGPSRLVYGAKIAFEKWWLWRYF |
| Ga0310810_101858863 | 3300033412 | Soil | MNRTIYPQGWPPFAATDARTWGPSPFIYWAKLLFEKWWLWRYF |
| Ga0316619_113657701 | 3300033414 | Soil | TYPTSWPPFGITDPRTWGPNRAIYWAKIGFEKWWLWRYF |
| Ga0373959_0095324_589_702 | 3300034820 | Rhizosphere Soil | MNRTIYPQGWPPFAATEARTWGPSPFIYWAKVGFEKWW |
| ⦗Top⦘ |