


| Basic Information | |
|---|---|
| Family ID | F096785 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 38 residues |
| Representative Sequence | LVSVPAERGPALEAEFGARKLFIRRIGRVEEGAGVVVE |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.23 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.077 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (22.115 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.808 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.769 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.70% β-sheet: 0.00% Coil/Unstructured: 80.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF01467 | CTP_transf_like | 77.88 |
| PF10143 | PhosphMutase | 7.69 |
| PF02628 | COX15-CtaA | 4.81 |
| PF13473 | Cupredoxin_1 | 3.85 |
| PF01676 | Metalloenzyme | 1.92 |
| PF00117 | GATase | 0.96 |
| PF01513 | NAD_kinase | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 4.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.08 % |
| Unclassified | root | N/A | 1.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0739446 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300000858|JGI10213J12805_11109533 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300000956|JGI10216J12902_109933977 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300000956|JGI10216J12902_121205125 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300005184|Ga0066671_10599178 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005184|Ga0066671_10784141 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300005329|Ga0070683_100501566 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300005454|Ga0066687_10185022 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300005544|Ga0070686_101062330 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005559|Ga0066700_10840164 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005560|Ga0066670_10363605 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300005561|Ga0066699_11071523 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005568|Ga0066703_10422358 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005574|Ga0066694_10479221 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005713|Ga0066905_100751753 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300006854|Ga0075425_101823734 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300009012|Ga0066710_104272108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300009088|Ga0099830_10297692 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300009137|Ga0066709_100419724 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
| 3300009156|Ga0111538_13529758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 542 | Open in IMG/M |
| 3300009789|Ga0126307_10726046 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300009818|Ga0105072_1062504 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300010039|Ga0126309_10156693 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300010039|Ga0126309_10658587 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300010045|Ga0126311_11714140 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300010166|Ga0126306_10014528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5075 | Open in IMG/M |
| 3300010166|Ga0126306_11668935 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300010304|Ga0134088_10116313 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300010325|Ga0134064_10461168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 520 | Open in IMG/M |
| 3300010337|Ga0134062_10433173 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300010373|Ga0134128_10630317 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300010373|Ga0134128_12596039 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300010396|Ga0134126_12256013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300011000|Ga0138513_100012676 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300011000|Ga0138513_100079505 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300011269|Ga0137392_10802107 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300012187|Ga0136622_10409616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300012189|Ga0137388_10445656 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300012198|Ga0137364_10495637 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300012204|Ga0137374_11263377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 512 | Open in IMG/M |
| 3300012350|Ga0137372_10885004 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012353|Ga0137367_10025410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4595 | Open in IMG/M |
| 3300012353|Ga0137367_10538895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 820 | Open in IMG/M |
| 3300012357|Ga0137384_10837790 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300012358|Ga0137368_10594652 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300012398|Ga0134051_1094393 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300012882|Ga0157304_1102572 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300012897|Ga0157285_10181858 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300012907|Ga0157283_10034774 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300012939|Ga0162650_100043309 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300012984|Ga0164309_10453685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus | 970 | Open in IMG/M |
| 3300012984|Ga0164309_11113199 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300014326|Ga0157380_12826067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 552 | Open in IMG/M |
| 3300014497|Ga0182008_10728429 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300015373|Ga0132257_103541812 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300018027|Ga0184605_10251702 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300018051|Ga0184620_10268074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 574 | Open in IMG/M |
| 3300018053|Ga0184626_10380444 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300018431|Ga0066655_10128840 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300018468|Ga0066662_11905337 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300019361|Ga0173482_10758631 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300020005|Ga0193697_1124656 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300021445|Ga0182009_10513099 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300022694|Ga0222623_10340180 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300023072|Ga0247799_1006784 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300025916|Ga0207663_10144275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1662 | Open in IMG/M |
| 3300025921|Ga0207652_10136087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2194 | Open in IMG/M |
| 3300025922|Ga0207646_10258289 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
| 3300025928|Ga0207700_10051449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3074 | Open in IMG/M |
| 3300025961|Ga0207712_10722678 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300025981|Ga0207640_10121685 | All Organisms → cellular organisms → Bacteria | 1871 | Open in IMG/M |
| 3300026078|Ga0207702_11345312 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300026118|Ga0207675_101597690 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300026312|Ga0209153_1070578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1271 | Open in IMG/M |
| 3300026536|Ga0209058_1275231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 581 | Open in IMG/M |
| 3300027691|Ga0209485_1262533 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300027775|Ga0209177_10412246 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300027862|Ga0209701_10448966 | Not Available | 710 | Open in IMG/M |
| 3300028705|Ga0307276_10126791 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300028716|Ga0307311_10068336 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300028716|Ga0307311_10110428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 773 | Open in IMG/M |
| 3300028719|Ga0307301_10008963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2819 | Open in IMG/M |
| 3300028719|Ga0307301_10247253 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300028755|Ga0307316_10013983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2514 | Open in IMG/M |
| 3300028771|Ga0307320_10218556 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300028778|Ga0307288_10347066 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300028787|Ga0307323_10070550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1241 | Open in IMG/M |
| 3300028807|Ga0307305_10051707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1892 | Open in IMG/M |
| 3300028810|Ga0307294_10067828 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300028811|Ga0307292_10067401 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300028814|Ga0307302_10706884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 501 | Open in IMG/M |
| 3300028878|Ga0307278_10426655 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300028880|Ga0307300_10165474 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300030336|Ga0247826_10273268 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300030336|Ga0247826_11247429 | Not Available | 597 | Open in IMG/M |
| 3300030336|Ga0247826_11278128 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300030511|Ga0268241_10130191 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300031114|Ga0308187_10227604 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300031720|Ga0307469_11167040 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300031903|Ga0307407_11176717 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300031912|Ga0306921_12622795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 520 | Open in IMG/M |
| 3300031939|Ga0308174_11953140 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031943|Ga0310885_10607740 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300034671|Ga0314796_170559 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 22.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.46% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.58% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.77% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.85% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.88% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.92% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.92% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012187 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ448 (21.06) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_07394461 | 2228664021 | Soil | GGLLVSIPAEQGPELEAEFASRKLFLRRVGSVEEGSGVVVE |
| JGI10213J12805_111095332 | 3300000858 | Soil | LLVSVPADRGPTLEAEFAARRLFLRRIGRVEEGSGVLVR* |
| JGI10216J12902_1099339771 | 3300000956 | Soil | VSVAAERATALEAEFESRKLFVRRIGRVEEGTGVVVE* |
| JGI10216J12902_1212051251 | 3300000956 | Soil | LPAERGAALEAEFAARRLFLRRIGRVEEGAGVHVM* |
| Ga0066671_105991782 | 3300005184 | Soil | GGLLVSVPAERGAVLEAEFAARRLFIRRVGSVEEGSGVVVD* |
| Ga0066671_107841411 | 3300005184 | Soil | LLVSLPADQGAALEAEFEAKKLFLRRIGRVEEGSGVLVT* |
| Ga0070683_1005015661 | 3300005329 | Corn Rhizosphere | GGLLVSLPSQQGPALEAEFGSRRLFLRRVGTVEEGVGVVVV* |
| Ga0066687_101850221 | 3300005454 | Soil | LLVSLPAAQGPALEAEFAARRLFIRRIGYVEEGSGVLVE* |
| Ga0070686_1010623301 | 3300005544 | Switchgrass Rhizosphere | AGGLLVSLPSEQGPALEAEFGSRRLFLRRVGTVEEGAGVVVV* |
| Ga0066700_108401642 | 3300005559 | Soil | TAGGLLIALAADRGATFEAEMQARRLFVRRIGRVEEGAGVVVE* |
| Ga0066670_103636051 | 3300005560 | Soil | LLVSLPSEQGAALEAEFAARRLFIRRIGRVEEGSGVRVQ* |
| Ga0066699_110715231 | 3300005561 | Soil | LLVSVPAEQGPALEAEFEAHKLFIRRIGRVEEGSGVSVS* |
| Ga0066703_104223581 | 3300005568 | Soil | VSIPAERAAALEAEFEARKLFIRRVGRVEEGVGVVVE* |
| Ga0066694_104792212 | 3300005574 | Soil | VTLPSEQGAVLEAQFSSRRLFLRRVGTVEEGAGVVVV* |
| Ga0066905_1007517533 | 3300005713 | Tropical Forest Soil | SLPAHQGPVLEAEFSSRRLFLRRVGTVEEGSGVLVV* |
| Ga0075425_1018237342 | 3300006854 | Populus Rhizosphere | PGERAGALEAEFTARKLFIRRIGRVEEGSGVTVE* |
| Ga0066710_1042721082 | 3300009012 | Grasslands Soil | LVTLPADRCAVLEAEFAARDLPVWRIGSVEQGSGVEVT |
| Ga0099830_102976923 | 3300009088 | Vadose Zone Soil | VSLPAEQGPALEAEFGARRLFVRRIGRVEEGAGVLVE* |
| Ga0066709_1004197244 | 3300009137 | Grasslands Soil | GLLISLPSEQGPALEAEFEARKLFIRRIGRVEEGSGVVVQ* |
| Ga0111538_135297581 | 3300009156 | Populus Rhizosphere | SVPAERGAALEAEFSSRRLFIRRIGSVEEGAGVAVS* |
| Ga0126307_107260462 | 3300009789 | Serpentine Soil | GLLVSLPRERGPALEAAFERHGLFIRRIGSVEEGAGVLVR* |
| Ga0105072_10625042 | 3300009818 | Groundwater Sand | VPSERGPALEAEFGARRLFIRRIGRVEEGAGVVVQ* |
| Ga0126309_101566933 | 3300010039 | Serpentine Soil | VSVPAERGPVLEAEFAARRLFVRRVGRVEEGSGVVVE* |
| Ga0126309_106585872 | 3300010039 | Serpentine Soil | VPAERGAALEAEFDARRLFIRRVGRVEEGSGVAVN* |
| Ga0126311_117141402 | 3300010045 | Serpentine Soil | GGLLVSVPAERGATLEAEFTARRLFVRRIGFVEEGSGVVVQ* |
| Ga0126306_100145287 | 3300010166 | Serpentine Soil | VSLPAERSATIDAEFSAQRLFLRRIGRVEEGGGVVVQ* |
| Ga0126306_116689351 | 3300010166 | Serpentine Soil | VPSERGAVLEAEFQAKKLFLRRVGRVEEGAGVVVE* |
| Ga0134088_101163131 | 3300010304 | Grasslands Soil | GLLVSLPSEQGPALEAEFAKRRLFVRRIGRVEEGVGLFVE* |
| Ga0134064_104611681 | 3300010325 | Grasslands Soil | PSDRGVALEAEFGARRLFIRRIGRVEEGTGVVVE* |
| Ga0134062_104331732 | 3300010337 | Grasslands Soil | LPVERGAALEAEFSARRLFIRRIGYVEEGSGVVVE* |
| Ga0134128_106303171 | 3300010373 | Terrestrial Soil | LPSEQGTALEAEFASRRLFLRRVGTVEEGTGVLVV* |
| Ga0134128_125960392 | 3300010373 | Terrestrial Soil | LLISLPSEQGPALEAEFEAHKLFIRRIGRVEEGFGVQVQ* |
| Ga0134126_122560131 | 3300010396 | Terrestrial Soil | SLPADRGAVLQASFESRGLFLRRSGHVEEGAGVVVQ* |
| Ga0138513_1000126763 | 3300011000 | Soil | TLPKERGAALEAEFDARKLFIRRIGTIEEGAGVVVE* |
| Ga0138513_1000795052 | 3300011000 | Soil | ALPSEQGAVLEAEFTSRRLFLRRVGTVEEGSGVLVV* |
| Ga0137392_108021073 | 3300011269 | Vadose Zone Soil | GGLLVSVPAEQGAALEAEFEGRKLFVRRIGRVEEGAGVFVE* |
| Ga0136622_104096161 | 3300012187 | Polar Desert Sand | LPSAKAAVLEAAFVSVGLFIRRIGRVEPGRGVHLE* |
| Ga0137388_104456561 | 3300012189 | Vadose Zone Soil | SVPAERGAALEAEFESRRLFIRRIGRVEEGAGVIVE* |
| Ga0137364_104956373 | 3300012198 | Vadose Zone Soil | PAEQGPALEAEFAKRRLFVRRIGRVEEGAGVFVE* |
| Ga0137374_112633772 | 3300012204 | Vadose Zone Soil | LVSIPAERGPALEAEFAARRLFIRRIGRVEEGAGVTVE* |
| Ga0137372_108850042 | 3300012350 | Vadose Zone Soil | VSVPAERGAALEAEFSARKLFIRRIGRVEEGAGVIVE* |
| Ga0137367_100254106 | 3300012353 | Vadose Zone Soil | CLPADRAAVLQASFDAADLFLQRIGRVEEGSGVVIA* |
| Ga0137367_105388951 | 3300012353 | Vadose Zone Soil | LISLPSDRGAALEAEFTARKLFIRRIGRVEEGAGVVVE* |
| Ga0137384_108377901 | 3300012357 | Vadose Zone Soil | SIRGDQAAALEAEFMARGLFIRRIGRVEEGAGVVVE* |
| Ga0137368_105946522 | 3300012358 | Vadose Zone Soil | VSLPAERGAALEAEFTARKLFIRRIGRVEEGAGVTVE* |
| Ga0134051_10943932 | 3300012398 | Grasslands Soil | VSVPAERGVALEAEFTAKRLFIRRIGRVEEGAGVVVE* |
| Ga0157304_11025722 | 3300012882 | Soil | VSVPAERGPALEAEFEAQKLFIRRIGRVEDGAGVVVR* |
| Ga0157285_101818581 | 3300012897 | Soil | LLISLPSEQGPALEAEFEADKLFIRRIGRVEEGFGVQVQ* |
| Ga0157283_100347741 | 3300012907 | Soil | VSVAGERAAALEAEFESRKLFVRRVGHVEEGAGVVVE* |
| Ga0162650_1000433091 | 3300012939 | Soil | SGGLLVSIPALQGPVLEAEFAERRLFLRRIGSVEEGTGVIVE* |
| Ga0164309_104536853 | 3300012984 | Soil | LVFLLYDRGAALEAEFSTRRLFLRRIGRVEEGIGVVVE* |
| Ga0164309_111131992 | 3300012984 | Soil | LLVSLPAQQGAALEAEFAARRLFLRRIGRVEEGAGVYVE* |
| Ga0157380_128260672 | 3300014326 | Switchgrass Rhizosphere | LVSVPAERGAALEAEFSSRRLFIRRIGSVEEGAGVTVS* |
| Ga0182008_107284291 | 3300014497 | Rhizosphere | GGLLVAIPSERGPALEAEFGSRKLFIRRVGAVEEGSGVVVE* |
| Ga0132257_1035418122 | 3300015373 | Arabidopsis Rhizosphere | LPADRGPAMEAEFTARKLFIRRIGRVESGAGVTVV* |
| Ga0184605_102517022 | 3300018027 | Groundwater Sediment | ISGERAPALQAEFESHKLFIRRVGRVEEGAGVVVE |
| Ga0184620_102680742 | 3300018051 | Groundwater Sediment | LVSLPAEQGAALEAEFAARRLFLRRIGRVEEGAGVFVE |
| Ga0184626_103804442 | 3300018053 | Groundwater Sediment | LVALPSEHGAVLEAEFTSKRFFLRRVGTVEEGSGVLVV |
| Ga0066655_101288401 | 3300018431 | Grasslands Soil | SLPAEQGPALEAEFGARRLFVRRIGRVEEGSGVVVQ |
| Ga0066662_119053371 | 3300018468 | Grasslands Soil | TLPAEHGAALEAEFTARKLFIRRIGRVEEGAGVLVR |
| Ga0173482_107586312 | 3300019361 | Soil | GLLISLPSEQGPALEAEFEARKLFIRRIGRVEEGSGVQVQ |
| Ga0193697_11246562 | 3300020005 | Soil | LVSIPAERAAALEAEFESRKLFIRRVGRVEEGSGVVVG |
| Ga0182009_105130991 | 3300021445 | Soil | VSLPGEQASALEAEFMARGLFVRRIGSVEEGVGVVVE |
| Ga0222623_103401801 | 3300022694 | Groundwater Sediment | PAEQSATLEAEFAARKLFLRRVGAVEEGSGVVVAG |
| Ga0247799_10067841 | 3300023072 | Soil | VAGERAAALEAEFESRKLFVRRVGHVEEGAGVVVE |
| Ga0207663_101442753 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GLLISLPSEQGPALEADFEAHKLFIRRIGRVEEGFGVQVQ |
| Ga0207652_101360871 | 3300025921 | Corn Rhizosphere | SVPAERGPALEAEFESGKLFIRRVGRVEEGSGVVVA |
| Ga0207646_102582893 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SLPADRGAALEAEFTTKRLFIRRIGRVEEGNGVVVE |
| Ga0207700_100514495 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | SLPSEQGSALEAEFEAHKLFIRRIGRVEEGSGVLVQ |
| Ga0207712_107226783 | 3300025961 | Switchgrass Rhizosphere | LPSEQGPALEAEFEAHKLFIRRIGRVEEGFGVQVQ |
| Ga0207640_101216854 | 3300025981 | Corn Rhizosphere | SLPGDRGAALEAEFASRKLFVRRVGRVEEGQGVVVE |
| Ga0207702_113453122 | 3300026078 | Corn Rhizosphere | GLLVTIPAERGPALEAEFESRKLFLRRVGRVEEGAGVSVT |
| Ga0207675_1015976901 | 3300026118 | Switchgrass Rhizosphere | SVPPERGPMLEAEFAARHLFLRRIGAVEEGSGVYVE |
| Ga0209153_10705783 | 3300026312 | Soil | GGLLVSVPAERGAVLEAEFAARRLFIRRVGSVEEGSGVVVD |
| Ga0209058_12752311 | 3300026536 | Soil | VSLPSEQGPALEAEFAKRRLFVRRIGRVEEGAGLFVE |
| Ga0209485_12625332 | 3300027691 | Agricultural Soil | GLLVSLPHERGPALEAEFERNGLFIRRIGSVEEGAGVLVR |
| Ga0209177_104122461 | 3300027775 | Agricultural Soil | GLLVSIAADRAPALEAEFDSRKLFIRRVGRVEEGAGVVVE |
| Ga0209701_104489661 | 3300027862 | Vadose Zone Soil | GGLLVSLPAQQGPALEAEFAAQRLFLRRIGSVEEGSGVYVE |
| Ga0307276_101267912 | 3300028705 | Soil | SIPAERGPALEAEFASRKLFVRRVGRVEEGAGVVVE |
| Ga0307311_100683361 | 3300028716 | Soil | LPAERGAALEAEFAGRRLFIRRIGRVEEGAGVIVE |
| Ga0307311_101104283 | 3300028716 | Soil | SLPAEQGAALEAEFAARRLFLRRIGRVEEGAGVFVE |
| Ga0307301_100089634 | 3300028719 | Soil | LLVSLPAEQGPTLEAEFGARRLFLRRIGSVEEGSGIYVE |
| Ga0307301_102472532 | 3300028719 | Soil | SLSAEKGAALEAEFEGRWLFLRRIGSVEEGSGVVVE |
| Ga0307316_100139834 | 3300028755 | Soil | VPAERGAALEAEFGARKLFIRRIGRVEEGAGVVVE |
| Ga0307320_102185561 | 3300028771 | Soil | GLLVSVSGERAPALQAEFESRKLFVRRVGRVEEGAGVVVE |
| Ga0307288_103470661 | 3300028778 | Soil | VSLPSQQGAALEAEFAARRLFLRRVGTVDAGAGVLVV |
| Ga0307323_100705501 | 3300028787 | Soil | GGLLISLPSEQGPALEADFEAHKLFIRRIGRVEEGFGVQVQ |
| Ga0307305_100517071 | 3300028807 | Soil | GGLLVSAPPERGPVLEAEFAARHLFLRRIGAVEEGAGVYVD |
| Ga0307294_100678283 | 3300028810 | Soil | IPGERAPALEAEFQSRKLFVRRVGRVEEGAGVIVE |
| Ga0307292_100674013 | 3300028811 | Soil | SIPAERAPALEAEFESRKLFVRRVGRVEEGAGVVVS |
| Ga0307302_107068842 | 3300028814 | Soil | LVSVPAERGPALEAEFGARKLFIRRIGRVEEGAGVVVE |
| Ga0307278_104266551 | 3300028878 | Soil | GLLVSMPVERGAVLEAEFQAKSSFLRRVGRVEEGSGVVVE |
| Ga0307300_101654742 | 3300028880 | Soil | LVTLPAEQSATLEAEFATRKLFLRRVGAIEEGSGVVVAG |
| Ga0247826_102732683 | 3300030336 | Soil | SLPARQAPVLEAEFGERRLFLRRVGVVEEGSGVVVE |
| Ga0247826_112474291 | 3300030336 | Soil | LPADKAPVLQAEFESRKLFACRVGRVVEGSGVALR |
| Ga0247826_112781281 | 3300030336 | Soil | LISIPADRGPALEAEFLSRRLFIRRIGSVEEGSGVVVQ |
| Ga0268241_101301911 | 3300030511 | Soil | SLPAERGAALEAEFAAKKLFIRRIGRVEEGVGVVVE |
| Ga0308187_102276042 | 3300031114 | Soil | SLPAEQGPALEAAFAERRLFIRRIGRVEEGAGVFVE |
| Ga0307469_111670403 | 3300031720 | Hardwood Forest Soil | LVTLPAERGPALEAEFAARRLFIRRIGRVEEGAGVIVE |
| Ga0307407_111767171 | 3300031903 | Rhizosphere | LVSVAGERAPALEAEFASRRLFIRRVGRVEEGAGVLVE |
| Ga0306921_126227951 | 3300031912 | Soil | TVPAERGPALEAEFGAKKLFIRRIGSVEEGAGVLVG |
| Ga0308174_119531401 | 3300031939 | Soil | SIPAERGAALEAEFAARKLFIRRIGSVEEGSGVVVE |
| Ga0310885_106077401 | 3300031943 | Soil | LPADQGAALEAEFDARRLFIRRIGRVEEGSGVVVE |
| Ga0314796_170559_2_130 | 3300034671 | Soil | AGGLLVSIAADRGPALEAEYDSRKLFIRRVGRVEEGAGVVVE |
| ⦗Top⦘ |