


| Basic Information | |
|---|---|
| Family ID | F096680 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 38 residues |
| Representative Sequence | METILPSVIFVSMIVVFGVDATRKRRDFLKKHKRA |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 64.42 % |
| % of genes near scaffold ends (potentially truncated) | 13.46 % |
| % of genes from short scaffolds (< 2000 bps) | 74.04 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.692 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (8.654 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.231 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (36.538 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 47.62% β-sheet: 0.00% Coil/Unstructured: 52.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF02811 | PHP | 49.04 |
| PF01975 | SurE | 6.73 |
| PF05235 | CHAD | 4.81 |
| PF02518 | HATPase_c | 2.88 |
| PF13263 | PHP_C | 1.92 |
| PF00005 | ABC_tran | 1.92 |
| PF01895 | PhoU | 1.92 |
| PF00300 | His_Phos_1 | 1.92 |
| PF13432 | TPR_16 | 0.96 |
| PF13489 | Methyltransf_23 | 0.96 |
| PF00486 | Trans_reg_C | 0.96 |
| PF13177 | DNA_pol3_delta2 | 0.96 |
| PF12706 | Lactamase_B_2 | 0.96 |
| PF00528 | BPD_transp_1 | 0.96 |
| PF01695 | IstB_IS21 | 0.96 |
| PF12849 | PBP_like_2 | 0.96 |
| PF01022 | HTH_5 | 0.96 |
| PF00834 | Ribul_P_3_epim | 0.96 |
| PF13531 | SBP_bac_11 | 0.96 |
| PF13340 | DUF4096 | 0.96 |
| PF13188 | PAS_8 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0496 | Broad specificity polyphosphatase and 5'/3'-nucleotidase SurE | Replication, recombination and repair [L] | 6.73 |
| COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 4.81 |
| COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 4.81 |
| COG0036 | Pentose-5-phosphate-3-epimerase | Carbohydrate transport and metabolism [G] | 0.96 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.69 % |
| Unclassified | root | N/A | 17.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090005|LWSO_GFMCQXZ02GHVT9 | Not Available | 523 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10029738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2267 | Open in IMG/M |
| 3300000228|TB_PC08_66DRAFT_10039308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1871 | Open in IMG/M |
| 3300000230|TB_GS10_10DRAFT_10004301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila | 8601 | Open in IMG/M |
| 3300000230|TB_GS10_10DRAFT_10097412 | Not Available | 1137 | Open in IMG/M |
| 3300000233|TB_FS06_10DRAFT_1017362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2435 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_104677742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 522 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_109639284 | Not Available | 521 | Open in IMG/M |
| 3300001765|MIS_1000127 | All Organisms → cellular organisms → Bacteria | 42586 | Open in IMG/M |
| 3300002024|MIS_1141224 | Not Available | 1050 | Open in IMG/M |
| 3300002026|MIS_10002140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila | 21461 | Open in IMG/M |
| 3300002026|MIS_10026601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila | 5862 | Open in IMG/M |
| 3300002027|MIS_10041164 | All Organisms → cellular organisms → Bacteria | 2940 | Open in IMG/M |
| 3300002027|MIS_10057424 | All Organisms → cellular organisms → Bacteria | 2608 | Open in IMG/M |
| 3300002027|MIS_10109867 | All Organisms → cellular organisms → Bacteria | 1967 | Open in IMG/M |
| 3300003432|JGI20214J51088_10527965 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300003541|JGI20214J51650_10408365 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300004282|Ga0066599_100614691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 731 | Open in IMG/M |
| 3300004780|Ga0062378_10120755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 667 | Open in IMG/M |
| 3300005077|Ga0071116_1010363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila | 8123 | Open in IMG/M |
| 3300005659|Ga0073900_10198153 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300005829|Ga0074479_10319474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 988 | Open in IMG/M |
| 3300005829|Ga0074479_10740509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 557 | Open in IMG/M |
| 3300005831|Ga0074471_10851558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales | 3682 | Open in IMG/M |
| 3300005831|Ga0074471_11052952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1112 | Open in IMG/M |
| 3300005905|Ga0075269_10100486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 550 | Open in IMG/M |
| 3300005982|Ga0075156_10045393 | All Organisms → cellular organisms → Bacteria | 2558 | Open in IMG/M |
| 3300006092|Ga0082021_1016645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales | 7077 | Open in IMG/M |
| 3300007521|Ga0105044_10193690 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
| 3300009009|Ga0105105_10080710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1533 | Open in IMG/M |
| 3300009009|Ga0105105_10462503 | Not Available | 719 | Open in IMG/M |
| 3300009009|Ga0105105_10557893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 663 | Open in IMG/M |
| 3300009009|Ga0105105_10641651 | Not Available | 625 | Open in IMG/M |
| 3300009009|Ga0105105_10849410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 555 | Open in IMG/M |
| 3300009032|Ga0105048_10005564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 20341 | Open in IMG/M |
| 3300009081|Ga0105098_10542574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 598 | Open in IMG/M |
| 3300009083|Ga0105047_10000766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 55846 | Open in IMG/M |
| 3300009091|Ga0102851_11793465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 691 | Open in IMG/M |
| 3300009131|Ga0115027_10607956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila | 806 | Open in IMG/M |
| 3300009131|Ga0115027_11456990 | Not Available | 560 | Open in IMG/M |
| 3300009131|Ga0115027_11488211 | Not Available | 555 | Open in IMG/M |
| 3300009131|Ga0115027_11767381 | Not Available | 517 | Open in IMG/M |
| 3300009146|Ga0105091_10132185 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300009179|Ga0115028_10368381 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300010293|Ga0116204_1270226 | Not Available | 534 | Open in IMG/M |
| 3300011428|Ga0137456_1151975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 621 | Open in IMG/M |
| 3300012018|Ga0119867_1153030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 614 | Open in IMG/M |
| 3300012146|Ga0137322_1029818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 780 | Open in IMG/M |
| 3300012166|Ga0137350_1120270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 532 | Open in IMG/M |
| 3300012956|Ga0154020_10184635 | All Organisms → cellular organisms → Bacteria | 1939 | Open in IMG/M |
| 3300012956|Ga0154020_10452223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1087 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10105100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila | 1633 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10264804 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| (restricted) 3300013125|Ga0172369_10316258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 819 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10000302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 75267 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10117277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1966 | Open in IMG/M |
| 3300014303|Ga0075358_1020560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 942 | Open in IMG/M |
| 3300014303|Ga0075358_1060883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 664 | Open in IMG/M |
| 3300015251|Ga0180070_1040341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 620 | Open in IMG/M |
| 3300018084|Ga0184629_10243079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 939 | Open in IMG/M |
| 3300020048|Ga0207193_1002084 | All Organisms → cellular organisms → Bacteria | 35219 | Open in IMG/M |
| 3300020048|Ga0207193_1028242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6609 | Open in IMG/M |
| 3300020213|Ga0163152_10075005 | All Organisms → cellular organisms → Bacteria | 2227 | Open in IMG/M |
| 3300021063|Ga0206227_1130409 | Not Available | 509 | Open in IMG/M |
| 3300021090|Ga0210377_10487395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 714 | Open in IMG/M |
| 3300021333|Ga0210324_1272325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 863 | Open in IMG/M |
| (restricted) 3300023208|Ga0233424_10026251 | All Organisms → cellular organisms → Bacteria | 2875 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10007337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 15579 | Open in IMG/M |
| 3300025115|Ga0209835_1163890 | Not Available | 534 | Open in IMG/M |
| 3300027739|Ga0209575_10125736 | Not Available | 928 | Open in IMG/M |
| 3300027762|Ga0209288_10107503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 878 | Open in IMG/M |
| 3300027762|Ga0209288_10228741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 611 | Open in IMG/M |
| 3300027776|Ga0209277_10127945 | Not Available | 1108 | Open in IMG/M |
| 3300027878|Ga0209181_10000374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 84583 | Open in IMG/M |
| 3300027887|Ga0208980_10086213 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300027890|Ga0209496_10187287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 975 | Open in IMG/M |
| 3300027899|Ga0209668_10665073 | Not Available | 698 | Open in IMG/M |
| 3300028283|Ga0268283_1090354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 896 | Open in IMG/M |
| 3300028646|Ga0302159_10068376 | Not Available | 787 | Open in IMG/M |
| 3300028649|Ga0302162_10125851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 609 | Open in IMG/M |
| 3300028676|Ga0302167_10046286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1317 | Open in IMG/M |
| 3300028804|Ga0268298_10000940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 36144 | Open in IMG/M |
| 3300028804|Ga0268298_10019987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 5081 | Open in IMG/M |
| 3300028804|Ga0268298_10313478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 809 | Open in IMG/M |
| 3300029981|Ga0302293_10046508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 1531 | Open in IMG/M |
| 3300030055|Ga0302173_10324472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 589 | Open in IMG/M |
| 3300030492|Ga0302212_1085009 | Not Available | 854 | Open in IMG/M |
| 3300030943|Ga0311366_10070987 | All Organisms → cellular organisms → Bacteria | 2991 | Open in IMG/M |
| 3300031521|Ga0311364_12409789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 513 | Open in IMG/M |
| 3300031902|Ga0302322_101957749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 719 | Open in IMG/M |
| 3300032420|Ga0335397_10000442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 53364 | Open in IMG/M |
| 3300033418|Ga0316625_100746691 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300033433|Ga0326726_11093506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 775 | Open in IMG/M |
| 3300033482|Ga0316627_101351069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 713 | Open in IMG/M |
| 3300033482|Ga0316627_102328957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 562 | Open in IMG/M |
| 3300033521|Ga0316616_100219588 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
| 3300033521|Ga0316616_102061456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 757 | Open in IMG/M |
| 3300033557|Ga0316617_100014030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Levilinea → Levilinea saccharolytica | 3876 | Open in IMG/M |
| 3300033557|Ga0316617_100949639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 837 | Open in IMG/M |
| 3300034101|Ga0335027_0554337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 709 | Open in IMG/M |
| 3300034155|Ga0370498_042978 | Not Available | 993 | Open in IMG/M |
| 3300034156|Ga0370502_0028104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 1758 | Open in IMG/M |
| 3300034158|Ga0370507_0108154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 870 | Open in IMG/M |
| 3300034196|Ga0370503_0256197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 633 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 8.65% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 8.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.69% |
| Sinkhole Freshwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.73% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 5.77% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 4.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 4.81% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 4.81% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.85% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 3.85% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 3.85% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 2.88% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 1.92% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.92% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.92% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 1.92% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 1.92% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.96% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 0.96% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.96% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.96% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.96% |
| Sinkhole | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole | 0.96% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.96% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.96% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.96% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.96% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.96% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.96% |
| Wastewater Treatment Plant | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090005 | Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 1 | Environmental | Open in IMG/M |
| 3300000228 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_66 | Environmental | Open in IMG/M |
| 3300000230 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- GS10_10 | Environmental | Open in IMG/M |
| 3300000233 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- FS06_10 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001765 | Sinkhole freshwater microbial communities from Lake Huron, USA - combined 2007-2012 | Environmental | Open in IMG/M |
| 3300002024 | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1k-1.5k | Environmental | Open in IMG/M |
| 3300002026 | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 5k+ | Environmental | Open in IMG/M |
| 3300002027 | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k | Environmental | Open in IMG/M |
| 3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
| 3300005077 | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 | Environmental | Open in IMG/M |
| 3300005659 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit | Engineered | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
| 3300005905 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 | Environmental | Open in IMG/M |
| 3300005982 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA | Engineered | Open in IMG/M |
| 3300006092 | Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore | Engineered | Open in IMG/M |
| 3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009032 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009083 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
| 3300011428 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2 | Environmental | Open in IMG/M |
| 3300012018 | Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Activated sludge (MBR) | Engineered | Open in IMG/M |
| 3300012146 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2 | Environmental | Open in IMG/M |
| 3300012166 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2 | Environmental | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
| 3300013125 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300014303 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D1 | Environmental | Open in IMG/M |
| 3300015251 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10D | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020213 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP8.IB-2 | Environmental | Open in IMG/M |
| 3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021333 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023208 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG | Environmental | Open in IMG/M |
| 3300024054 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG | Environmental | Open in IMG/M |
| 3300025115 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027776 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027878 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 (SPAdes) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028283 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_36m | Environmental | Open in IMG/M |
| 3300028646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300028649 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_2 | Environmental | Open in IMG/M |
| 3300028676 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_1 | Environmental | Open in IMG/M |
| 3300028804 | Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt | Engineered | Open in IMG/M |
| 3300029981 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_2 | Environmental | Open in IMG/M |
| 3300030055 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_1 | Environmental | Open in IMG/M |
| 3300030492 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_2 | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300032420 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly) | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
| 3300034156 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18 | Environmental | Open in IMG/M |
| 3300034158 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_18 | Environmental | Open in IMG/M |
| 3300034196 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LWSO_01169240 | 2088090005 | Freshwater Sediment | METILPSVIFVSMVVIFGVDATRKRRDFLKKHKRA |
| TB_PC08_66DRAFT_100297381 | 3300000228 | Groundwater | MERIMQTILPSVIFLSIVIVFGVDANRKRRDFLKKRNRA* |
| TB_PC08_66DRAFT_100393083 | 3300000228 | Groundwater | METIFPSVLFLSMIIVFSVDATRKRREFLKKHNRA* |
| TB_GS10_10DRAFT_100043016 | 3300000230 | Groundwater | METILPSVIFLSMVVVFGVDATRKRREFLKKRNRI* |
| TB_GS10_10DRAFT_100974121 | 3300000230 | Groundwater | METILPSVIFVSMIVVFGVDATRKRRDFLKKHKRA* |
| TB_FS06_10DRAFT_10173623 | 3300000233 | Groundwater | MQTILPSVIFLSIVIVFGVDANRKRRDFLKKRNRA* |
| JGIcombinedJ13530_1046777422 | 3300001213 | Wetland | METIIPSVIFVSLIVVFGVDARQKRRDFLRKQKQA* |
| JGIcombinedJ13530_1096392841 | 3300001213 | Wetland | METILPSVIFVSMVVIFGVDATRKRRAFLKKHKRA* |
| MIS_100012714 | 3300001765 | Sinkhole Freshwater | MQTILPSVIFLSMVIIFGVDATRKRRAFLKKHNHN* |
| MIS_11412242 | 3300002024 | Sinkhole Freshwater | MELIMETILQSVVFVSMIVVFGVDATRKRREFLKKRNRA* |
| MIS_1000214017 | 3300002026 | Sinkhole Freshwater | METILPSVIFLSMVVVFGVDATRKRREFLKKHDRA* |
| MIS_100266013 | 3300002026 | Sinkhole Freshwater | METILPSVIFLSMVVVFGVDATRKRRDFLKKRNRI* |
| MIS_100411645 | 3300002027 | Sinkhole Freshwater | METILPSVIFLSMVVVFGVDASRKRREFLKKRNRI* |
| MIS_100574243 | 3300002027 | Sinkhole Freshwater | MGTILPSVIFLSMIVVFSVDAAQKRRAYLKKRKLT* |
| MIS_101098673 | 3300002027 | Sinkhole Freshwater | METIFPAFIFVSIVVVFSVDANRKRREFLKKYRSE* |
| JGI20214J51088_105279652 | 3300003432 | Wetland | MESIMETILPSVIFLSMIVVFGVDATRKRREFLKKQKRV* |
| JGI20214J51650_104083652 | 3300003541 | Wetland | VYHFSIQMESIMETILPSVIFLSMIVVFGVDATRKRREFLKKQKRV* |
| Ga0066599_1006146911 | 3300004282 | Freshwater | MESIMETILPSVIFLSMVVVFGVDATRKRREFLKKHNRA* |
| Ga0062378_101207552 | 3300004780 | Wetland Sediment | MYHIEHRNGEHMETILPSVIFVSMIVIFGVDATRKRRDFLKKQKRA* |
| Ga0071116_10103634 | 3300005077 | Sinkhole | MELSMETILQSVVFVSMIIVFGVDATRKRREFLRKHKRA* |
| Ga0073900_101981532 | 3300005659 | Activated Sludge | METILPSVIFLSMVVVFSVDATRKRREFLKKHKSA* |
| Ga0074479_103194743 | 3300005829 | Sediment (Intertidal) | METILPSVIFVSMVVVFGLDATRKRRDFLKKNKRA* |
| Ga0074479_107405091 | 3300005829 | Sediment (Intertidal) | RNGERMETILPSVIFVSMIVIFGVDATRKRRDFLKKQKNA* |
| Ga0074471_108515583 | 3300005831 | Sediment (Intertidal) | MGALVPSVIFLSMVIIFGVDAKRKRRDFLKKQKQA* |
| Ga0074471_110529522 | 3300005831 | Sediment (Intertidal) | MQTILPSVIFLSMVVIFGVDASRKRRDFLKKRNRT* |
| Ga0075269_101004861 | 3300005905 | Rice Paddy Soil | ETILPSVIFVSMVIVFGVDATRKRRDFLKKHKRA* |
| Ga0075156_100453933 | 3300005982 | Wastewater Effluent | METILPSVIFVSMVVIFGVDATRKRRDFLKKIKRA* |
| Ga0082021_10166455 | 3300006092 | Wastewater Treatment Plant | METILSSVIFVSMVLVFGVDATRKRRDYLKKRSRN* |
| Ga0105044_101936902 | 3300007521 | Freshwater | METILTSVIFVSMVVIFGVDATRKRRDFLKKHKRA* |
| Ga0105105_100807101 | 3300009009 | Freshwater Sediment | MESIMQTILPSVIFLSMVIVFGVDATLKRREFLKKNNRV* |
| Ga0105105_104625031 | 3300009009 | Freshwater Sediment | MENFMETILPSVIFLSMIVVFGVDATRKRREFLKKNNRA* |
| Ga0105105_105578932 | 3300009009 | Freshwater Sediment | MELVMETIVQSVIFISMIVIFGVDASRKRREFLKKQNRS* |
| Ga0105105_106416512 | 3300009009 | Freshwater Sediment | MESFMETILPSVIFLSMVVVFGVDATRKRREFLKKRNRT* |
| Ga0105105_108494101 | 3300009009 | Freshwater Sediment | MEIIMETILQSVVFVSMIVVFGVDATRKRREFLRKQKRA* |
| Ga0105048_1000556410 | 3300009032 | Freshwater | MYHLIIENGAYMETFLPSVIFLSMVVVFSVDATRKRRDFLKKRNRS* |
| Ga0105098_105425742 | 3300009081 | Freshwater Sediment | MGTYQMEIIMQTILPSVIFLSMIVVFGVDASRKRRDFLRKQKRA* |
| Ga0105047_1000076632 | 3300009083 | Freshwater | METILPSVIFVSIVVVFSIDATRKRRDFLKKHKRA* |
| Ga0102851_117934651 | 3300009091 | Freshwater Wetlands | METILPSVIFVSMMIVFGVDATRKRRDFLKKRNRA* |
| Ga0115027_106079562 | 3300009131 | Wetland | METILPSVIFVSMIVIFGVDASRKRRDFLKKRKRA* |
| Ga0115027_114569901 | 3300009131 | Wetland | METILPSVIFVSMVVIFGVDAAIKRRDFLKKHKRA* |
| Ga0115027_114882112 | 3300009131 | Wetland | MEINMETIFQSVVFVSMIIVFGVDATRKRRDFLRKQKRA* |
| Ga0115027_117673811 | 3300009131 | Wetland | MERFMETLLPSVIFLSMVIVFGVDASRKRREFLKKQNQT* |
| Ga0105091_101321852 | 3300009146 | Freshwater Sediment | MENIMETILPSVIFLSMVVIFGVDATRKRREFLKKRNRA* |
| Ga0115028_103683812 | 3300009179 | Wetland | MESIMQTILPSVIFLSMVIVFGVDASRKRRDFLKKNNRV* |
| Ga0116204_12702261 | 3300010293 | Anoxic Lake Water | MEIIMETILQSVIFISMIVVFGVDATHKRREFLRKQKRA* |
| Ga0137456_11519751 | 3300011428 | Soil | CRNGEYMETILPSVIFVSMIVIFGVDAARKRRDFLKKHKRA* |
| Ga0119867_11530302 | 3300012018 | Activated Sludge | METIFPSFLILSMVVVFSVDATRKRREFLNKRKTA* |
| Ga0137322_10298182 | 3300012146 | Soil | METILPSVIFVSMVVIFGVDATRKRRDFLKKHKRA* |
| Ga0137350_11202701 | 3300012166 | Soil | LKSKINTLMYHGYIEMESVMETILPSVIFVSIIVVFGVDATRKRRDFLKKHKRA* |
| Ga0154020_101846352 | 3300012956 | Active Sludge | METILPSVIFLSMVVVISVDATRKRREFLKKHKSA* |
| Ga0154020_104522233 | 3300012956 | Active Sludge | YMETILPSVIFLSMVVVFSVDATRKRREFLKKHKSA* |
| (restricted) Ga0172368_101051002 | 3300013123 | Freshwater | METILPSVIFLSMIIVFSVDASRKRREFLKKHKRA* |
| (restricted) Ga0172368_102648042 | 3300013123 | Freshwater | METILPSVIFLSMIIVFGVDGTRKRREYLKKQKRS* |
| (restricted) Ga0172369_103162582 | 3300013125 | Freshwater | ETILPSVIFLSMIIVFSVDASRKRREFLKKHKRA* |
| (restricted) Ga0172367_1000030266 | 3300013126 | Freshwater | MGIQMEIIMETILQSVVFVSMIVVFGVDATRKRREFLRKQKRA* |
| (restricted) Ga0172373_101172774 | 3300013131 | Freshwater | METLLSPFLFLSMIVVFSVDAQRKRREFLKKHTTA* |
| Ga0075358_10205601 | 3300014303 | Natural And Restored Wetlands | MAMEINMETIFQSVIFLSMIVVFGVDATRKRREFLRKQKRA* |
| Ga0075358_10608831 | 3300014303 | Natural And Restored Wetlands | RNGERMETILPSVIFVSMIVIFGVDATRKRRDFLKKHKRA* |
| Ga0180070_10403412 | 3300015251 | Soil | METILPSVIFVSMVVVFGVDAARKRRDFLKKRDRA* |
| Ga0184629_102430792 | 3300018084 | Groundwater Sediment | METIFTSIIFVSMVVVFGVDATRKRRDFLKKNKSA |
| Ga0207193_100208416 | 3300020048 | Freshwater Lake Sediment | METILPSVIFLSMVVVFGVDATRKRREFLKKHDRA |
| Ga0207193_10282426 | 3300020048 | Freshwater Lake Sediment | METILPSVIFLSMVVVFGVDASRKRREFLKKRNRI |
| Ga0163152_100750053 | 3300020213 | Freshwater Microbial Mat | METILTSVIFVSMVVIFGVDATRKRRDFLKKHKRA |
| Ga0206227_11304091 | 3300021063 | Deep Subsurface Sediment | METILPSVIFVSMVVVFGVDAARKRRDFLKKRNRA |
| Ga0210377_104873952 | 3300021090 | Groundwater Sediment | METILPSVIFLSMIVVFGVDATRKRRDFLKKHKRA |
| Ga0210324_12723252 | 3300021333 | Estuarine | METILPSVIFVSMVVVFGLDATRKRRDFLKKNKRA |
| (restricted) Ga0233424_100262513 | 3300023208 | Freshwater | MESIFPSVIFLSMIIIFSVDAKRKRRDFLKKNKRA |
| (restricted) Ga0233425_1000733716 | 3300024054 | Freshwater | MRIYPLEINMETILQSVVFVSMVIVFGVDATRKRREFLRKQKRA |
| Ga0209835_11638902 | 3300025115 | Anoxic Lake Water | MEIIMETILQSVIFISMIVVFGVDATHKRREFLRKQKRA |
| Ga0209575_101257362 | 3300027739 | Freshwater | MELIMETILQSVVFVSMIVVFGVDATRKRREFLKKRNRA |
| Ga0209288_101075032 | 3300027762 | Freshwater Sediment | METILPSVIFLSMIVVFGVDATRKRREFLKKNNRA |
| Ga0209288_102287412 | 3300027762 | Freshwater Sediment | MESFMETILPSVIFLSMVVVFGVDASRKRREFLKKRNRI |
| Ga0209277_101279452 | 3300027776 | Wastewater Effluent | METILPSVIFVSMVVIFGVDATRKRRDFLKKIKRA |
| Ga0209181_1000037425 | 3300027878 | Freshwater | MYHLIIENGAYMETFLPSVIFLSMVVVFSVDATRKRRDFLKKRNRS |
| Ga0208980_100862133 | 3300027887 | Wetland | METILPSVIFVSMIVIFGVDATRKRRDFLKKQKRA |
| Ga0209496_101872873 | 3300027890 | Wetland | MYHIEHRNGEHMETILPSVIFVSMIVIFGVDATRKRRDFLKKQKRA |
| Ga0209668_106650732 | 3300027899 | Freshwater Lake Sediment | MYHIEHRNGERMETILPSVIFVSIIVIFGVDATRKRRDFLKKQKRA |
| Ga0268283_10903542 | 3300028283 | Saline Water | METIIPSVIFLSMVVVFGVDANRKRRDFLKKHKRA |
| Ga0302159_100683761 | 3300028646 | Fen | METILPSIIFASIIVVFGVDATRKRRDFLKKHKRF |
| Ga0302162_101258512 | 3300028649 | Fen | METILPSVIFVSMVIVFGFDATRKRRDYLKKDKRA |
| Ga0302167_100462862 | 3300028676 | Fen | METILPSVIFVSMIVIFGVDATRKRRDFLKKHKRA |
| Ga0268298_1000094019 | 3300028804 | Activated Sludge | METIFPSFLFLSMVVVFSVDATRKRREFLKKRKTA |
| Ga0268298_100199873 | 3300028804 | Activated Sludge | METLLSPFLFLSMIVVFSVDAKRKRREFLKKHTPA |
| Ga0268298_103134781 | 3300028804 | Activated Sludge | METILPSVIFLSMVFVIGVDAARKRRDFLKKNKHAS |
| Ga0302293_100465082 | 3300029981 | Fen | METILPSVIFVSMIVVFGVDATRKRRDFLKKNKSA |
| Ga0302173_103244721 | 3300030055 | Fen | VSWHCRNGEHMETILPSVIFVSIVVVFGLDATRKRRDFLKKHKRA |
| Ga0302212_10850092 | 3300030492 | Fen | METILPSVIFVSMIVVFGVDATRKRRDFLKKNKRA |
| Ga0311366_100709871 | 3300030943 | Fen | METILPSVIFVSMVIVFGFDATRKRREFLKKHKRA |
| Ga0311364_124097892 | 3300031521 | Fen | EHMETILPSVIFVSIVVVFGLDATRKRRDFLKKHKRA |
| Ga0302322_1019577492 | 3300031902 | Fen | CMETILPSIIFASIIVVFGVDATRKRRDFLKKHKRF |
| Ga0335397_1000044241 | 3300032420 | Freshwater | METILPSVIFVSIVVVFSIDATRKRRDFLKKHKRA |
| Ga0316625_1007466912 | 3300033418 | Soil | MESFMETILPSVIFLSMVVVFGVDATRKRREFLKKRNRV |
| Ga0326726_110935062 | 3300033433 | Peat Soil | SEVSSHYRNGERMETILPSVIFVSMVVIFGVDAARKRRDFLKKNKRA |
| Ga0316627_1013510692 | 3300033482 | Soil | VRIQMEIIMETILQSVVFVSMIIVFGVDATRKRRDFLRKQKRA |
| Ga0316627_1023289572 | 3300033482 | Soil | KHRNGERMETILTSVIFVSIVVVFGVDATRKRRDFLKKHKRA |
| Ga0316616_1002195883 | 3300033521 | Soil | MRIYQMEIIMETFFQSVVFVSMIIVFGVDATRKRRDFLRKQKRS |
| Ga0316616_1020614562 | 3300033521 | Soil | METILPSMIFVSMIVIFGVDASRKRRDFLKKHKRA |
| Ga0316617_1000140305 | 3300033557 | Soil | METILPSVIFVSMVVIFGVDAAIKRRDFLKKHKRA |
| Ga0316617_1009496392 | 3300033557 | Soil | METIFQSVVFVSMIIVFGVDATRKRRDFLRKQKRA |
| Ga0335027_0554337_169_276 | 3300034101 | Freshwater | METILPSVIFLSMIIVFSLDATRKRREFLKNQKPT |
| Ga0370498_042978_872_991 | 3300034155 | Untreated Peat Soil | MESFMETILPSVIFLSMVVVFGVDATRKRRAFLKKRSRI |
| Ga0370502_0028104_1424_1531 | 3300034156 | Untreated Peat Soil | METILPSVIFVSMVVIFGLDATRKRRDFLKKHKRA |
| Ga0370507_0108154_51_170 | 3300034158 | Untreated Peat Soil | MESFMETILPSVIFLSMVVIFGVDATRKRRAFLKKRSRI |
| Ga0370503_0256197_2_127 | 3300034196 | Untreated Peat Soil | YRNGEYMETILPSVIFVSMVVIFGLDATRKRRDFLKKHKRA |
| ⦗Top⦘ |