


| Basic Information | |
|---|---|
| Family ID | F096673 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MSFTIMQHDGMKVVQWFSTVDELLKSMLANPKDRYWRNK |
| Number of Associated Samples | 62 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 69.23 % |
| % of genes near scaffold ends (potentially truncated) | 18.27 % |
| % of genes from short scaffolds (< 2000 bps) | 45.19 % |
| Associated GOLD sequencing projects | 49 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (40.385 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (58.654 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.885 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (90.385 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.93% β-sheet: 20.90% Coil/Unstructured: 64.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF13155 | Toprim_2 | 6.73 |
| PF03796 | DnaB_C | 6.73 |
| PF06945 | DUF1289 | 5.77 |
| PF12705 | PDDEXK_1 | 3.85 |
| PF01612 | DNA_pol_A_exo1 | 3.85 |
| PF10124 | Mu-like_gpT | 3.85 |
| PF11753 | DUF3310 | 3.85 |
| PF00476 | DNA_pol_A | 3.85 |
| PF00149 | Metallophos | 2.88 |
| PF00145 | DNA_methylase | 2.88 |
| PF03237 | Terminase_6N | 2.88 |
| PF00436 | SSB | 1.92 |
| PF16786 | RecA_dep_nuc | 1.92 |
| PF04545 | Sigma70_r4 | 1.92 |
| PF01464 | SLT | 1.92 |
| PF13392 | HNH_3 | 0.96 |
| PF01242 | PTPS | 0.96 |
| PF13482 | RNase_H_2 | 0.96 |
| PF06147 | DUF968 | 0.96 |
| PF07120 | DUF1376 | 0.96 |
| PF13712 | Glyco_tranf_2_5 | 0.96 |
| PF00271 | Helicase_C | 0.96 |
| PF02195 | ParBc | 0.96 |
| PF00589 | Phage_integrase | 0.96 |
| PF11351 | GTA_holin_3TM | 0.96 |
| PF06048 | DUF927 | 0.96 |
| PF13384 | HTH_23 | 0.96 |
| PF13884 | Peptidase_S74 | 0.96 |
| PF04404 | ERF | 0.96 |
| PF12236 | Head-tail_con | 0.96 |
| PF15943 | YdaS_antitoxin | 0.96 |
| PF02739 | 5_3_exonuc_N | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 6.73 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 6.73 |
| COG3313 | Predicted Fe-S protein YdhL, DUF1289 family | General function prediction only [R] | 5.77 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 3.85 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 2.88 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 1.92 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 1.92 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.96 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.96 |
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 0.96 |
| COG5519 | Predicted ATPase domain of Cch-like helicases, DUF927 family | General function prediction only [R] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.62 % |
| Unclassified | root | N/A | 40.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002933|G310J44882_10070030 | Not Available | 756 | Open in IMG/M |
| 3300003785|Ga0007851_100359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3550 | Open in IMG/M |
| 3300004448|Ga0065861_1162019 | Not Available | 726 | Open in IMG/M |
| 3300004460|Ga0066222_1011229 | All Organisms → Viruses → Predicted Viral | 3106 | Open in IMG/M |
| 3300004460|Ga0066222_1067136 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300004774|Ga0007794_10170540 | Not Available | 650 | Open in IMG/M |
| 3300004805|Ga0007792_10194868 | Not Available | 623 | Open in IMG/M |
| 3300006105|Ga0007819_1065883 | Not Available | 753 | Open in IMG/M |
| 3300006109|Ga0007870_1066503 | Not Available | 698 | Open in IMG/M |
| 3300007542|Ga0099846_1061117 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii | 1418 | Open in IMG/M |
| 3300009068|Ga0114973_10097792 | All Organisms → Viruses → Predicted Viral | 1671 | Open in IMG/M |
| 3300009082|Ga0105099_10793676 | Not Available | 592 | Open in IMG/M |
| 3300009152|Ga0114980_10030899 | All Organisms → Viruses → Predicted Viral | 3313 | Open in IMG/M |
| 3300009152|Ga0114980_10093599 | All Organisms → Viruses → Predicted Viral | 1798 | Open in IMG/M |
| 3300009152|Ga0114980_10116587 | All Organisms → Viruses → Predicted Viral | 1592 | Open in IMG/M |
| 3300009154|Ga0114963_10185130 | Not Available | 1214 | Open in IMG/M |
| 3300009155|Ga0114968_10004545 | Not Available | 10332 | Open in IMG/M |
| 3300009155|Ga0114968_10392570 | Not Available | 759 | Open in IMG/M |
| 3300009158|Ga0114977_10000978 | Not Available | 18881 | Open in IMG/M |
| 3300009158|Ga0114977_10009204 | Not Available | 6275 | Open in IMG/M |
| 3300009159|Ga0114978_10018572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5169 | Open in IMG/M |
| 3300009160|Ga0114981_10006194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7344 | Open in IMG/M |
| 3300009164|Ga0114975_10001503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16588 | Open in IMG/M |
| 3300009164|Ga0114975_10042958 | All Organisms → Viruses → Predicted Viral | 2682 | Open in IMG/M |
| 3300009164|Ga0114975_10061207 | All Organisms → Viruses → Predicted Viral | 2205 | Open in IMG/M |
| 3300009164|Ga0114975_10082015 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1875 | Open in IMG/M |
| 3300009164|Ga0114975_10130429 | Not Available | 1445 | Open in IMG/M |
| 3300009164|Ga0114975_10257292 | Not Available | 975 | Open in IMG/M |
| 3300009164|Ga0114975_10268934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 950 | Open in IMG/M |
| 3300009175|Ga0073936_10089520 | All Organisms → Viruses → Predicted Viral | 2569 | Open in IMG/M |
| 3300009180|Ga0114979_10000275 | Not Available | 34089 | Open in IMG/M |
| 3300009180|Ga0114979_10000708 | Not Available | 21991 | Open in IMG/M |
| 3300009180|Ga0114979_10104459 | All Organisms → Viruses → Predicted Viral | 1750 | Open in IMG/M |
| 3300009180|Ga0114979_10284933 | Not Available | 984 | Open in IMG/M |
| 3300009180|Ga0114979_10589232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300009182|Ga0114959_10003050 | Not Available | 13361 | Open in IMG/M |
| 3300009184|Ga0114976_10395904 | Not Available | 723 | Open in IMG/M |
| 3300009184|Ga0114976_10668697 | Not Available | 523 | Open in IMG/M |
| 3300010158|Ga0114960_10000357 | Not Available | 38219 | Open in IMG/M |
| 3300010160|Ga0114967_10033624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3405 | Open in IMG/M |
| 3300010334|Ga0136644_10174435 | Not Available | 1296 | Open in IMG/M |
| 3300010885|Ga0133913_10143423 | Not Available | 6390 | Open in IMG/M |
| 3300010885|Ga0133913_10799509 | All Organisms → Viruses → Predicted Viral | 2458 | Open in IMG/M |
| 3300010885|Ga0133913_11050971 | Not Available | 2101 | Open in IMG/M |
| 3300010885|Ga0133913_11866425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1500 | Open in IMG/M |
| 3300010885|Ga0133913_12627024 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
| 3300011921|Ga0120089_100146 | Not Available | 26484 | Open in IMG/M |
| 3300011921|Ga0120089_103714 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1589 | Open in IMG/M |
| 3300012665|Ga0157210_1000137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 38227 | Open in IMG/M |
| 3300013286|Ga0136641_1141439 | Not Available | 653 | Open in IMG/M |
| 3300017747|Ga0181352_1004353 | Not Available | 4897 | Open in IMG/M |
| 3300017754|Ga0181344_1001935 | Not Available | 7490 | Open in IMG/M |
| 3300017754|Ga0181344_1007414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3611 | Open in IMG/M |
| 3300017754|Ga0181344_1105133 | Not Available | 818 | Open in IMG/M |
| 3300017766|Ga0181343_1115845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300020707|Ga0214238_1001814 | All Organisms → Viruses → Predicted Viral | 4038 | Open in IMG/M |
| 3300020726|Ga0214220_1003047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3519 | Open in IMG/M |
| 3300021354|Ga0194047_10000344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31538 | Open in IMG/M |
| 3300022200|Ga0196901_1041554 | All Organisms → Viruses → Predicted Viral | 1749 | Open in IMG/M |
| 3300022555|Ga0212088_10007917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18030 | Open in IMG/M |
| 3300022555|Ga0212088_10009845 | Not Available | 15481 | Open in IMG/M |
| 3300022555|Ga0212088_10149349 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1978 | Open in IMG/M |
| 3300022594|Ga0236340_1015249 | All Organisms → Viruses → Predicted Viral | 2206 | Open in IMG/M |
| 3300025316|Ga0209697_10236014 | All Organisms → Viruses → Predicted Viral | 1005 | Open in IMG/M |
| 3300025428|Ga0208506_1013678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1563 | Open in IMG/M |
| 3300025723|Ga0208741_10002114 | All Organisms → Viruses | 7252 | Open in IMG/M |
| 3300025782|Ga0208867_1024550 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 904 | Open in IMG/M |
| 3300025838|Ga0208872_1028001 | All Organisms → Viruses → Predicted Viral | 2531 | Open in IMG/M |
| 3300027708|Ga0209188_1000500 | Not Available | 37860 | Open in IMG/M |
| 3300027733|Ga0209297_1000849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18668 | Open in IMG/M |
| 3300027733|Ga0209297_1003250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8719 | Open in IMG/M |
| 3300027733|Ga0209297_1072422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1518 | Open in IMG/M |
| 3300027733|Ga0209297_1187420 | Not Available | 828 | Open in IMG/M |
| 3300027734|Ga0209087_1001472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13843 | Open in IMG/M |
| 3300027734|Ga0209087_1003101 | Not Available | 9199 | Open in IMG/M |
| 3300027734|Ga0209087_1028747 | All Organisms → Viruses → Predicted Viral | 2673 | Open in IMG/M |
| 3300027734|Ga0209087_1049885 | All Organisms → Viruses → Predicted Viral | 1917 | Open in IMG/M |
| 3300027734|Ga0209087_1145090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 958 | Open in IMG/M |
| 3300027741|Ga0209085_1012113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4289 | Open in IMG/M |
| 3300027741|Ga0209085_1027988 | All Organisms → Viruses → Predicted Viral | 2682 | Open in IMG/M |
| 3300027747|Ga0209189_1047052 | All Organisms → Viruses → Predicted Viral | 2106 | Open in IMG/M |
| 3300027759|Ga0209296_1006148 | Not Available | 7596 | Open in IMG/M |
| 3300027759|Ga0209296_1022690 | All Organisms → Viruses → Predicted Viral | 3557 | Open in IMG/M |
| 3300027763|Ga0209088_10000338 | Not Available | 34093 | Open in IMG/M |
| 3300027763|Ga0209088_10009720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5232 | Open in IMG/M |
| 3300027763|Ga0209088_10328851 | Not Available | 611 | Open in IMG/M |
| 3300027782|Ga0209500_10010558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5709 | Open in IMG/M |
| 3300027782|Ga0209500_10059256 | All Organisms → Viruses → Predicted Viral | 2012 | Open in IMG/M |
| 3300027782|Ga0209500_10386969 | Not Available | 566 | Open in IMG/M |
| 3300027896|Ga0209777_10161748 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1835 | Open in IMG/M |
| 3300027963|Ga0209400_1001179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21783 | Open in IMG/M |
| 3300027969|Ga0209191_1023030 | All Organisms → Viruses → Predicted Viral | 3063 | Open in IMG/M |
| 3300027969|Ga0209191_1082148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1405 | Open in IMG/M |
| 3300027969|Ga0209191_1182869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
| (restricted) 3300027970|Ga0247837_1024844 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4640 | Open in IMG/M |
| 3300027974|Ga0209299_1045710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1836 | Open in IMG/M |
| 3300027974|Ga0209299_1154355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1007619 | Not Available | 11430 | Open in IMG/M |
| 3300028025|Ga0247723_1012275 | All Organisms → Viruses → Predicted Viral | 3229 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1005341 | Not Available | 10486 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1030270 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3688 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1215194 | Not Available | 720 | Open in IMG/M |
| 3300031772|Ga0315288_10087874 | Not Available | 3586 | Open in IMG/M |
| 3300032092|Ga0315905_10035692 | Not Available | 5051 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 58.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 8.65% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.81% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 4.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 2.88% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.92% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.92% |
| Mine Pit Pond | Environmental → Terrestrial → Geologic → Mine → Unclassified → Mine Pit Pond | 1.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.96% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.96% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.96% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
| 3300003785 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
| 3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011921 | Mine pit pond microbial communities from Vermont, USA - 2M | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300020707 | Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 hypolimnion | Environmental | Open in IMG/M |
| 3300020726 | Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 hypolimnion | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022555 | Alinen_combined assembly | Environmental | Open in IMG/M |
| 3300022594 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S1 | Environmental | Open in IMG/M |
| 3300025316 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025428 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jul08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025782 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025838 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| G310J44882_100700302 | 3300002933 | Freshwater | MGGLMSFIIYQKDGLRCIQYFFNTEQLIKSMLNNPNDSYHRNS* |
| Ga0007851_1003592 | 3300003785 | Freshwater | MSFNIYQTNGLRCIQWFFNTDELIKSMLNNPNDAYHRIT* |
| Ga0065861_11620193 | 3300004448 | Marine | MSFTITTKDGMRVDQWFRSVDELLQSMLNNPEDRYWRNT* |
| Ga0066222_10112294 | 3300004460 | Marine | MSFDIMTENGMRVTQWFSSIDELLRSMLSNPKDRYWRNK* |
| Ga0066222_10671361 | 3300004460 | Marine | MSFDIMTEKGMRVTQWFSSIDELLKSMLANPKDRYWRNT* |
| Ga0007794_101705402 | 3300004774 | Freshwater | MSFTIMQHDGMKAIQWFNTVDDLLKSMLANPNDAYHRNKS* |
| Ga0007792_101948683 | 3300004805 | Freshwater | MSFTIMQHDGMKTIQWFSNVDELIKSMLNNPKDRYYRNDDNRR* |
| Ga0007819_10658833 | 3300006105 | Freshwater | HDGMKVIQWFSTMDELINSMLNNPKDRYHRNDDNRR* |
| Ga0007870_10665031 | 3300006109 | Freshwater | MSFNIYQTNGLRCIQWFFNTDELIKSMLNNPNDAYHR |
| Ga0099846_10611172 | 3300007542 | Aqueous | MSFEIRTHDGMKVVQWFKDIDELIASMTANHKDTYHRNLYV* |
| Ga0114973_100977924 | 3300009068 | Freshwater Lake | MSFTIMQHDGMKVVQWFRSIDELLKSMLANPKDRYWRNK* |
| Ga0105099_107936762 | 3300009082 | Freshwater Sediment | MSFDIITKEGMRVTQWFTSVDELLKSMLANPKDRYWRNT* |
| Ga0114980_100308996 | 3300009152 | Freshwater Lake | MSFTIMQHDGMKVVQWFSTVDELLKSMLANPKDRYWRNK* |
| Ga0114980_100935995 | 3300009152 | Freshwater Lake | MSFTIMQHDGMKVVQWFFNIDELIKSMLNNPKDRYWRNG* |
| Ga0114980_101165872 | 3300009152 | Freshwater Lake | MSFTITTHNGMRIEQWFFSIDELIKSMIKNPNDRYWRNK* |
| Ga0114963_101851303 | 3300009154 | Freshwater Lake | MSFDIITEKGMRVTQWFSSIDELLKSMLANPKDRYWRNI* |
| Ga0114968_1000454514 | 3300009155 | Freshwater Lake | MSFTIYTHDGMKVIQWFFNMDELIKSMQTNYKDHYHRNS* |
| Ga0114968_103925703 | 3300009155 | Freshwater Lake | MSFTIMQHDGMKVVQWFSNVDQLIKPMLANPKDRYWR |
| Ga0114977_1000097820 | 3300009158 | Freshwater Lake | MSFTITTYDGMRVDQWFSSVDELLKSMLANPKDRYWRNG* |
| Ga0114977_1000920412 | 3300009158 | Freshwater Lake | MSFTIMQHDGMKVIMWFADVDILLISIKNNPKDHYHRNT* |
| Ga0114978_1001857212 | 3300009159 | Freshwater Lake | MSFDIMTEKGMRVTQWFSSVDELLKSMLANPKDRYWRNK* |
| Ga0114981_100061943 | 3300009160 | Freshwater Lake | MSFTIYTHDGMKQIQWFFNMDELIKAMLNNPKNHYHRNSN* |
| Ga0114975_100015036 | 3300009164 | Freshwater Lake | MSFDIITKEGMRVTQWFTSVDELLKSMLANPKDRYWRNS* |
| Ga0114975_100429585 | 3300009164 | Freshwater Lake | MSFTITTKEGMRVDQWFRSVDELVKSMLDNPHDRYWRNS* |
| Ga0114975_100612073 | 3300009164 | Freshwater Lake | MSFDIITKEGMRVTQWFTSIDELLKSMLANPKDRYWRNK* |
| Ga0114975_100820155 | 3300009164 | Freshwater Lake | VSFTIMQHDGMKVVQWFSNVDQLIKSMLANPKDRYWRNK* |
| Ga0114975_101304294 | 3300009164 | Freshwater Lake | MSFDIITKDGMRVTQWFSSVDELLKSMLNNPKDRYWRNK* |
| Ga0114975_102572922 | 3300009164 | Freshwater Lake | MSFDIITEKGMRVTQWFSSVDELLKSMLANPKDRYWRNT* |
| Ga0114975_102689341 | 3300009164 | Freshwater Lake | MSFTITTKDGMRIDQWFRSVDELVQSMLDNPKDRYWRN |
| Ga0073936_100895204 | 3300009175 | Freshwater Lake Hypolimnion | MSFTIMRHDGMKVTQWFRTIDELIASMLANPKDSYWRNK* |
| Ga0114979_100002756 | 3300009180 | Freshwater Lake | MERVSFTIYTHDGMKVVQWFKNVDELLKSMLNNPKDRYHRNE* |
| Ga0114979_100007081 | 3300009180 | Freshwater Lake | MSFDIITYEGMRVTQWFPTVDALLKSMLANPKDRYWRVL* |
| Ga0114979_101044593 | 3300009180 | Freshwater Lake | MSFTITTHDGMKVVQWFSTMDELLKSMLNNPKDRYWRNK* |
| Ga0114979_102849331 | 3300009180 | Freshwater Lake | MSFDILTHEGMRVTQWFTSVDELLKSMLANPKDRYWRNK* |
| Ga0114979_105892323 | 3300009180 | Freshwater Lake | MSFTIYTHDGMKVIQWFFNIDELIKAMINNPLDRYH |
| Ga0114959_100030507 | 3300009182 | Freshwater Lake | MSFEIMRHDGMKEIHWFTIDQLIKSMLANPKDRYWRIR* |
| Ga0114976_103959041 | 3300009184 | Freshwater Lake | MSFTIMQHDGMKVTQWFRTIDELIISMINNPHDRYYRN |
| Ga0114976_106686972 | 3300009184 | Freshwater Lake | MSFDILTHEGMRVTQWFTSVDDLLKSMLANPKDRYWRNK* |
| Ga0114960_1000035738 | 3300010158 | Freshwater Lake | MSFTIMRHDGMKETHWFSTIDDLLKSMLANPKDRYWRNK* |
| Ga0114967_100336246 | 3300010160 | Freshwater Lake | MSFTIMQHDGMKVVQWFSNVDQLIKSMLANPKDRYWRNK* |
| Ga0136644_101744352 | 3300010334 | Freshwater Lake | MSFTIMQHDGMKVTQWFSTIDELIKSMINNPKDVYHRNT* |
| Ga0133913_1014342315 | 3300010885 | Freshwater Lake | MSFTITTKEGMRVDQWFRSVDELLQSMLNNPEDRYWRNT* |
| Ga0133913_107995097 | 3300010885 | Freshwater Lake | MSFTITTKEGMRVDQWFRSVDELLQSMLDNPKDRYWRNS* |
| Ga0133913_110509716 | 3300010885 | Freshwater Lake | FTIYTHDGYKHIQWFFNMDELIKAMQTNYKDHYHRNS* |
| Ga0133913_118664254 | 3300010885 | Freshwater Lake | MSFDILTEKGMRVTQWFRSIDELLQSMKANPKDRYWRNT* |
| Ga0133913_126270243 | 3300010885 | Freshwater Lake | MSFEIITHKGMRMEQWFTSVDELLRSMANNPNDRYWRIR* |
| Ga0120089_10014619 | 3300011921 | Mine Pit Pond | MSFEIMQHNGMKIIQYFFSMDELIKSMLNNPKDRYWRIK* |
| Ga0120089_1037141 | 3300011921 | Mine Pit Pond | TNAMSFEIIQADGMRCIQWFFNTDELIKSMLNNPNDRYWRIG* |
| Ga0157210_100013716 | 3300012665 | Freshwater | MSFDIITKEGMRVTQWFSSVDELLKSMLANPKDRYWRNT* |
| Ga0136641_11414392 | 3300013286 | Freshwater | VSFTIMQHDGMKVNQWFNTIDDLLKSMLNNPKDAYHRNKS* |
| Ga0181352_10043535 | 3300017747 | Freshwater Lake | MSFTIMRHNGMKEIQYFFDIQSLIKSMLNNPKDAYHRNM |
| Ga0181344_100193514 | 3300017754 | Freshwater Lake | MSFTITTHNGMRVDQWFTSVDELIKSMINNPKDRYWRNS |
| Ga0181344_10074149 | 3300017754 | Freshwater Lake | MSFTIMRHNGMKEIQYFFSMDELIKSMLKNPKDAYHRNL |
| Ga0181344_11051331 | 3300017754 | Freshwater Lake | IWRRKGMRVTQWFSSVDELLKSMLANPKDRYWRNT |
| Ga0181343_11158451 | 3300017766 | Freshwater Lake | MSFTIMQHNGMKVIQYFFSMDELIKSMLKNPKDVYHRN |
| Ga0214238_100181411 | 3300020707 | Freshwater | MSFTIMQHDGMKVIQYFFNIDDLIKSMLNNPKDVYWRNT |
| Ga0214220_10030477 | 3300020726 | Freshwater | MRHDGMKVIQWFSNVDELIKSMLNNPKDRYYRNDNNHR |
| Ga0194047_1000034427 | 3300021354 | Anoxic Zone Freshwater | MSFSVYTHDGMKETQWFFSIDELINSMINNPLNRYHRNV |
| Ga0196901_10415546 | 3300022200 | Aqueous | MSFEIRTHDGMKVVQWFKDIDELIASMTANHKDTYHRNLYV |
| Ga0212088_1000791715 | 3300022555 | Freshwater Lake Hypolimnion | MSFTIMRHDGMKVTQWFRTIDELIASMLANPKDSYWRNK |
| Ga0212088_1000984513 | 3300022555 | Freshwater Lake Hypolimnion | MSFTIMQHDGMKAIQWFNTVDDLLKSMLANPNDAYHRNKS |
| Ga0212088_101493493 | 3300022555 | Freshwater Lake Hypolimnion | MQHDGMKVIQWFSTMDELINSMLNNPKDRYHRNDNNHR |
| Ga0236340_10152492 | 3300022594 | Freshwater | MSFTIMQHDGMKTIQWFSNVDELIKSMLNNPKDRYYRNDDNRR |
| Ga0209697_102360141 | 3300025316 | Freshwater Lake Hypolimnion | MSFTIMQHDGMKAIQWFNTVDDLLKSMLANPNDAYHR |
| Ga0208506_10136785 | 3300025428 | Freshwater | MSFNIYQTNGLRCIQWFFNTDELIKSMLNNPNDAYHRIT |
| Ga0208741_100021143 | 3300025723 | Freshwater | MQHDGMKVIQWFSNVDELIKSMLNNPKDRYHRNDNNHR |
| Ga0208867_10245503 | 3300025782 | Freshwater | DGMKVIQWFSTMDELINSMLNNPKDRYHRNDDNRR |
| Ga0208872_10280011 | 3300025838 | Freshwater | YQVDGIKVIQWFNNIDLLLISMLNNPQAVYHRNMK |
| Ga0209188_100050028 | 3300027708 | Freshwater Lake | MSFEIMRHDGMKEIHWFTIDQLIKSMLANPKDRYWRIR |
| Ga0209297_100084912 | 3300027733 | Freshwater Lake | MSFTITTYDGMRVDQWFSSVDELLKSMLANPKDRYWRNG |
| Ga0209297_10032504 | 3300027733 | Freshwater Lake | MSFTIMQHDGMKVIMWFADVDILLISIKNNPKDHYHRNT |
| Ga0209297_10724224 | 3300027733 | Freshwater Lake | MSFTIMQHDGMKVVQWFSNVDQLIKSMLANPKDRYWRNK |
| Ga0209297_11874204 | 3300027733 | Freshwater Lake | VSFTILTKDGMRVDQWFRSIDELLKSMLANPKDRYWRNG |
| Ga0209087_100147219 | 3300027734 | Freshwater Lake | MSFTITTKDGMRIDQWFRSVDELVQSMLDNPKDRYWRNS |
| Ga0209087_100310123 | 3300027734 | Freshwater Lake | MSFDIITKEGMRVTQWFTSVDELLKSMLANPKDRYWRNS |
| Ga0209087_10287473 | 3300027734 | Freshwater Lake | MSFDIITEKGMRVTQWFSSVDELLKSMLANPKDRYWRNT |
| Ga0209087_10498852 | 3300027734 | Freshwater Lake | MSFEIMRHDGMKVVQWFSTTDELIKSMINNPNDRYWRIR |
| Ga0209087_11450903 | 3300027734 | Freshwater Lake | TIYTHDGMKVIQWFFNIDELIKAMLNNPKDRYHRN |
| Ga0209085_101211313 | 3300027741 | Freshwater Lake | MSFTIYTHDGMKVIQWFFNIDELIKAMINNPLDRY |
| Ga0209085_10279886 | 3300027741 | Freshwater Lake | MSFDIITEKGMRVTQWFSSIDELLKSMLANPKDRYWRNI |
| Ga0209189_10470524 | 3300027747 | Freshwater Lake | MSFTIMRHDGMKETHWFSTIDDLLKSMLANPKDRYWRNK |
| Ga0209296_10061483 | 3300027759 | Freshwater Lake | MSFDIITKDGMRVTQWFSSVDELLKSMLNNPKDRYWRNK |
| Ga0209296_10226906 | 3300027759 | Freshwater Lake | MSFDILTHEGMRVTQWFTSVDELLKSMLANPKDRYWRNK |
| Ga0209088_1000033833 | 3300027763 | Freshwater Lake | MERVSFTIYTHDGMKVVQWFKNVDELLKSMLNNPKDRYHRNE |
| Ga0209088_100097205 | 3300027763 | Freshwater Lake | MSFTIMQHDGMKVVQWFSTVDELLKSMLANPKDRYWRNK |
| Ga0209088_103288511 | 3300027763 | Freshwater Lake | MSFDIITYEGMRVTQWFPTVDALLKSMLANPKDRYWRVL |
| Ga0209500_100105589 | 3300027782 | Freshwater Lake | VSFTIMQHDGMKVTQWFRSIDELLKSMLANPKDRYWRNK |
| Ga0209500_100592565 | 3300027782 | Freshwater Lake | MSFDIMTEKGMRVTQWFSSVDELLKSMLANPKDRYWRNK |
| Ga0209500_103869692 | 3300027782 | Freshwater Lake | MSFTITTHNGMRIEQWFFSIDELIKSMIKNPNDRYWRNK |
| Ga0209777_101617482 | 3300027896 | Freshwater Lake Sediment | MQHDGMKVIQWFSTMDELINSMLNNPKDRYHRNDDNRR |
| Ga0209400_100117927 | 3300027963 | Freshwater Lake | MSFTIYTHDGMKVIQWFFNMDELIKSMQTNYKDHYHRNS |
| Ga0209191_10230304 | 3300027969 | Freshwater Lake | MSFDIITKEGMRVTQWFTSIDELLKSMLANPKDRYWRNK |
| Ga0209191_10821484 | 3300027969 | Freshwater Lake | MSFDIITEKGMRVTQWFSSIDELVKSMLANPKDRYWRNT |
| Ga0209191_11828693 | 3300027969 | Freshwater Lake | TIYTHKGMKVIQYFFSIDELIKSMLNNPKDAYHRNL |
| (restricted) Ga0247837_10248442 | 3300027970 | Freshwater | MSFTITTHAGMRVDQWFHSVDELLSSMVKNPNDRYWRNT |
| Ga0209299_10457102 | 3300027974 | Freshwater Lake | MSFTIYTHDGMKQIQWFFNMDELIKAMLNNPKNHYHRNSN |
| Ga0209299_11543553 | 3300027974 | Freshwater Lake | MSFTIMQHDGMKVVQWFFNIDELIKSMLNNPKDRYWRNG |
| (restricted) Ga0247834_10076194 | 3300027977 | Freshwater | MSFTILSQDGTMFIQWFFNIDELIKAMQNNPKDTYHRNV |
| Ga0247723_10122753 | 3300028025 | Deep Subsurface Sediment | MSFTIITKEGMRVDQWFRSIDELLQSMKANPNDRYWRNS |
| (restricted) Ga0247835_100534115 | 3300028114 | Freshwater | MSFTITTHDGMKVIQYFFNVDELIKSMLNNPRDRYWRNK |
| (restricted) Ga0247843_10302705 | 3300028569 | Freshwater | MQHDGMKVIQWFFNIDELIKSMLNNPQDRYYRNDDNNR |
| (restricted) Ga0247843_12151941 | 3300028569 | Freshwater | MSFTIMQHDGMKVIQYFFNIDELIKSMLNNPKDTYHRNV |
| Ga0315288_100878744 | 3300031772 | Sediment | MSFTIYTHDGMKVEQYFFSINELIISMIANSKDRYHRNT |
| Ga0315905_100356927 | 3300032092 | Freshwater | MSFTIYTDTGMRVIQYFFNIDELIKSMLNNPKDRYHRNS |
| ⦗Top⦘ |