


| Basic Information | |
|---|---|
| Family ID | F096617 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MANQRDIDRRNDVRFLTPLLLMALVLVIGILVYAYTGHAAAAIG |
| Number of Associated Samples | 69 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.04 % |
| % of genes near scaffold ends (potentially truncated) | 22.12 % |
| % of genes from short scaffolds (< 2000 bps) | 76.92 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (19.231 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.731 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.923 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.33% β-sheet: 0.00% Coil/Unstructured: 41.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF08883 | DOPA_dioxygen | 18.27 |
| PF09954 | DUF2188 | 12.50 |
| PF06718 | DUF1203 | 5.77 |
| PF02582 | DUF155 | 3.85 |
| PF01613 | Flavin_Reduct | 3.85 |
| PF06779 | MFS_4 | 3.85 |
| PF13458 | Peripla_BP_6 | 2.88 |
| PF06736 | TMEM175 | 2.88 |
| PF02653 | BPD_transp_2 | 1.92 |
| PF07729 | FCD | 0.96 |
| PF13561 | adh_short_C2 | 0.96 |
| PF00731 | AIRC | 0.96 |
| PF08546 | ApbA_C | 0.96 |
| PF07758 | DUF1614 | 0.96 |
| PF08327 | AHSA1 | 0.96 |
| PF03992 | ABM | 0.96 |
| PF02668 | TauD | 0.96 |
| PF00725 | 3HCDH | 0.96 |
| PF00067 | p450 | 0.96 |
| PF09821 | AAA_assoc_C | 0.96 |
| PF00939 | Na_sulph_symp | 0.96 |
| PF04116 | FA_hydroxylase | 0.96 |
| PF03450 | CO_deh_flav_C | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG3805 | Aromatic ring-cleaving dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 18.27 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 3.85 |
| COG1723 | Mitochondrial translation protein, Rmd1/RMND1/DUF155 family | Translation, ribosomal structure and biogenesis [J] | 3.85 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 2.88 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.96 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.96 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.96 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.96 |
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.96 |
| COG4089 | Uncharacterized membrane protein | Function unknown [S] | 0.96 |
| COG0471 | Di- and tricarboxylate antiporter | Carbohydrate transport and metabolism [G] | 0.96 |
| COG1055 | Na+/H+ antiporter NhaD or related arsenite permease | Inorganic ion transport and metabolism [P] | 0.96 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.96 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.00 % |
| Unclassified | root | N/A | 25.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459021|G14TP7Y01CCKBO | Not Available | 704 | Open in IMG/M |
| 3300005093|Ga0062594_100114355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga antarctica | 1658 | Open in IMG/M |
| 3300005533|Ga0070734_10233310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1057 | Open in IMG/M |
| 3300005534|Ga0070735_10117477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1665 | Open in IMG/M |
| 3300005541|Ga0070733_10389710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 926 | Open in IMG/M |
| 3300005542|Ga0070732_10800634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Paracraurococcus → Paracraurococcus ruber | 575 | Open in IMG/M |
| 3300005764|Ga0066903_103962412 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300005764|Ga0066903_107418653 | Not Available | 566 | Open in IMG/M |
| 3300007982|Ga0102924_1004826 | All Organisms → cellular organisms → Bacteria | 13345 | Open in IMG/M |
| 3300009518|Ga0116128_1018312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2401 | Open in IMG/M |
| 3300009519|Ga0116108_1019667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2330 | Open in IMG/M |
| 3300009523|Ga0116221_1450441 | Not Available | 562 | Open in IMG/M |
| 3300009621|Ga0116116_1158334 | Not Available | 592 | Open in IMG/M |
| 3300009698|Ga0116216_10695308 | Not Available | 611 | Open in IMG/M |
| 3300009824|Ga0116219_10513357 | Not Available | 662 | Open in IMG/M |
| 3300009826|Ga0123355_10684246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1184 | Open in IMG/M |
| 3300009826|Ga0123355_11621537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300010049|Ga0123356_10649540 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300010049|Ga0123356_11380127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 866 | Open in IMG/M |
| 3300010343|Ga0074044_10179353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1411 | Open in IMG/M |
| 3300010376|Ga0126381_101502518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 973 | Open in IMG/M |
| 3300010379|Ga0136449_100501308 | Not Available | 2108 | Open in IMG/M |
| 3300010379|Ga0136449_101902885 | Not Available | 884 | Open in IMG/M |
| 3300010396|Ga0134126_12368069 | Not Available | 578 | Open in IMG/M |
| 3300012089|Ga0153924_1018853 | Not Available | 1419 | Open in IMG/M |
| 3300014156|Ga0181518_10058861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2267 | Open in IMG/M |
| 3300014325|Ga0163163_10787075 | Not Available | 1014 | Open in IMG/M |
| 3300014495|Ga0182015_10484555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 791 | Open in IMG/M |
| 3300014501|Ga0182024_10003114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 40085 | Open in IMG/M |
| 3300014501|Ga0182024_10025433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10453 | Open in IMG/M |
| 3300014501|Ga0182024_10443690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1666 | Open in IMG/M |
| 3300014501|Ga0182024_10676184 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300016270|Ga0182036_11801949 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300017929|Ga0187849_1123829 | Not Available | 1069 | Open in IMG/M |
| 3300017932|Ga0187814_10202467 | Not Available | 746 | Open in IMG/M |
| 3300017938|Ga0187854_10210569 | Not Available | 856 | Open in IMG/M |
| 3300017941|Ga0187850_10102758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1383 | Open in IMG/M |
| 3300017943|Ga0187819_10074655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2020 | Open in IMG/M |
| 3300017943|Ga0187819_10251921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1033 | Open in IMG/M |
| 3300017955|Ga0187817_10314525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 999 | Open in IMG/M |
| 3300017955|Ga0187817_10341585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 955 | Open in IMG/M |
| 3300017955|Ga0187817_10575728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 718 | Open in IMG/M |
| 3300017955|Ga0187817_10969654 | Not Available | 544 | Open in IMG/M |
| 3300017961|Ga0187778_10481427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 822 | Open in IMG/M |
| 3300017972|Ga0187781_10001349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 18542 | Open in IMG/M |
| 3300017972|Ga0187781_10958730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 624 | Open in IMG/M |
| 3300017972|Ga0187781_11230087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300017973|Ga0187780_10494970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 873 | Open in IMG/M |
| 3300017995|Ga0187816_10215199 | Not Available | 836 | Open in IMG/M |
| 3300018009|Ga0187884_10007391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7176 | Open in IMG/M |
| 3300018019|Ga0187874_10033648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2510 | Open in IMG/M |
| 3300018062|Ga0187784_10168964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1787 | Open in IMG/M |
| 3300018062|Ga0187784_10836846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 734 | Open in IMG/M |
| 3300018062|Ga0187784_11634122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 510 | Open in IMG/M |
| 3300018085|Ga0187772_10946769 | Not Available | 627 | Open in IMG/M |
| 3300018085|Ga0187772_11365108 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300018085|Ga0187772_11435939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 513 | Open in IMG/M |
| 3300018086|Ga0187769_10151544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1698 | Open in IMG/M |
| 3300018086|Ga0187769_10501966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 915 | Open in IMG/M |
| 3300018086|Ga0187769_10880549 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300018088|Ga0187771_10204048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1641 | Open in IMG/M |
| 3300018090|Ga0187770_10836880 | Not Available | 737 | Open in IMG/M |
| 3300021402|Ga0210385_10215442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1401 | Open in IMG/M |
| 3300021420|Ga0210394_10000723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 63362 | Open in IMG/M |
| 3300021420|Ga0210394_10193292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1774 | Open in IMG/M |
| 3300022557|Ga0212123_10010198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 13362 | Open in IMG/M |
| 3300025439|Ga0208323_1066974 | Not Available | 618 | Open in IMG/M |
| 3300025498|Ga0208819_1047080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1013 | Open in IMG/M |
| 3300025914|Ga0207671_10599426 | Not Available | 878 | Open in IMG/M |
| 3300025931|Ga0207644_10006735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 7486 | Open in IMG/M |
| 3300027568|Ga0208042_1072812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 873 | Open in IMG/M |
| 3300027826|Ga0209060_10294247 | Not Available | 741 | Open in IMG/M |
| 3300027854|Ga0209517_10163491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1411 | Open in IMG/M |
| 3300027895|Ga0209624_10934442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Paracraurococcus → Paracraurococcus ruber | 565 | Open in IMG/M |
| 3300030659|Ga0316363_10220332 | Not Available | 783 | Open in IMG/M |
| 3300031708|Ga0310686_100539630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3221 | Open in IMG/M |
| 3300031708|Ga0310686_111904490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1345 | Open in IMG/M |
| 3300031823|Ga0307478_10035662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3617 | Open in IMG/M |
| 3300031890|Ga0306925_10392145 | Not Available | 1489 | Open in IMG/M |
| 3300031910|Ga0306923_10817268 | Not Available | 1028 | Open in IMG/M |
| 3300031954|Ga0306926_12979925 | Not Available | 506 | Open in IMG/M |
| 3300032076|Ga0306924_10622237 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300032160|Ga0311301_10361837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2257 | Open in IMG/M |
| 3300032160|Ga0311301_10836056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1256 | Open in IMG/M |
| 3300032770|Ga0335085_10014308 | All Organisms → cellular organisms → Bacteria | 11588 | Open in IMG/M |
| 3300032783|Ga0335079_10695471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1063 | Open in IMG/M |
| 3300032783|Ga0335079_11397717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 695 | Open in IMG/M |
| 3300032805|Ga0335078_10047492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6359 | Open in IMG/M |
| 3300032805|Ga0335078_10073189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5002 | Open in IMG/M |
| 3300032805|Ga0335078_10391295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1829 | Open in IMG/M |
| 3300032805|Ga0335078_10659733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1306 | Open in IMG/M |
| 3300032805|Ga0335078_10784897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1164 | Open in IMG/M |
| 3300032805|Ga0335078_11132967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 911 | Open in IMG/M |
| 3300032805|Ga0335078_12089472 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 602 | Open in IMG/M |
| 3300032892|Ga0335081_10478067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1575 | Open in IMG/M |
| 3300032895|Ga0335074_10120020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3408 | Open in IMG/M |
| 3300032895|Ga0335074_10149773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2954 | Open in IMG/M |
| 3300032895|Ga0335074_10429742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1413 | Open in IMG/M |
| 3300032896|Ga0335075_10257972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2000 | Open in IMG/M |
| 3300032896|Ga0335075_10357729 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
| 3300032896|Ga0335075_10503661 | Not Available | 1237 | Open in IMG/M |
| 3300032896|Ga0335075_10537661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1180 | Open in IMG/M |
| 3300033158|Ga0335077_10021750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8029 | Open in IMG/M |
| 3300033158|Ga0335077_11559339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense | 630 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 19.23% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 15.38% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.62% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.69% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.81% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.81% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 3.85% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.96% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.96% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012089 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4NP_02695570 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | MANQRDIDRQNDTRFLTPLLPMATVLAVGILVYAFTGHAMPAAGSQTKGLI |
| Ga0062594_1001143553 | 3300005093 | Soil | MTSQQDRRYDMRLLMPLLLMATLLAFGILAFAVTGHALAAGG* |
| Ga0070734_102333101 | 3300005533 | Surface Soil | MPSRRDSDRRNDARFLTPLLLMALLMLCGILVYVYTGHPLA* |
| Ga0070735_101174772 | 3300005534 | Surface Soil | HQRRASMPNQRDRDRANDTHFLTPLLLIAVIVACGILLYAYTGHALAAAG* |
| Ga0070733_103897102 | 3300005541 | Surface Soil | MPNQRDRDRVNDAHFLTPLLLIAVIVACGILLYAYTGHALATAG* |
| Ga0070732_108006342 | 3300005542 | Surface Soil | MANQRDRDRVNDAHFLTPLLLIAVIVACGILLYAYTGHALATAG* |
| Ga0066903_1039624122 | 3300005764 | Tropical Forest Soil | MADQRDLDRRNDMRLLTPLLLMATILAFGILAYALTGHALAAGG* |
| Ga0066903_1074186532 | 3300005764 | Tropical Forest Soil | MTSQQDRRNDMRLLTPLLLMATLLAFGILAFALTGH |
| Ga0102924_100482620 | 3300007982 | Iron-Sulfur Acid Spring | MPGAMLNRRDLDRKNDIRLLTPLLLMAAILAAGILIYAYTGHSLAAAG* |
| Ga0116128_10183121 | 3300009518 | Peatland | MPNQRDIDRRNDVRFLTLLLLMALVLVIGILVYAYTGHAAAAIG* |
| Ga0116108_10196672 | 3300009519 | Peatland | MANQRDIDRRNDVRFLTPLLLMTLVLVIGILVYSYTVHAAAAIG* |
| Ga0116221_14504411 | 3300009523 | Peatlands Soil | MPNQRDIDRRNDIRFLTPLLLMALVLVIGTLVYAYTGHAAAAIG* |
| Ga0116116_11583341 | 3300009621 | Peatland | IDRRNDVRFLTPLLLMTLVLVIGILVYSYTVHAAAAIG* |
| Ga0116216_106953083 | 3300009698 | Peatlands Soil | RNDVRFLTPLLLMALVLVVGILVYSYTGHAAAAIG* |
| Ga0116219_105133572 | 3300009824 | Peatlands Soil | MANQRDIERRNDIRFLTPRLLIALVLVIGILLYAYTGHAAAAIG* |
| Ga0123355_106842463 | 3300009826 | Termite Gut | LIAMQMEKQSDLDRRNDRALLTPLLLMALVLVLGILVYAYTGHALAAAI* |
| Ga0123355_116215372 | 3300009826 | Termite Gut | VIAMQMEKQSDLDRRNDRALLTPLLLMALVLVLGILLYVYTGHASAAPT* |
| Ga0123356_106495402 | 3300010049 | Termite Gut | VIAMQMEKQSDLDRKNDRALLTPLLLMALVLVLGILFYVYTGHASAAAT* |
| Ga0123356_113801272 | 3300010049 | Termite Gut | LIAMQMEKQSDLDRRNDRALITPLLLMALVVVLGMLFYAYTGHALAAAI* |
| Ga0074044_101793532 | 3300010343 | Bog Forest Soil | MANQRDIDRRNDVRFLTPLLLMALVLVIGILVYGYAGHAAVAIG* |
| Ga0126381_1015025183 | 3300010376 | Tropical Forest Soil | METQSDLDRRNDIRLLTPLLLMALILVGGILLYTYTGHAAAI* |
| Ga0136449_1005013082 | 3300010379 | Peatlands Soil | MANQRDIERRNVIRFLTPLLLMALVLVIGILLNAYTGHAAAAIG* |
| Ga0136449_1019028852 | 3300010379 | Peatlands Soil | MANQRDIDRRNDVRFLTPLLLMALVLVIGILVYSYTGHAAAAIG* |
| Ga0134126_123680691 | 3300010396 | Terrestrial Soil | NNDLKFLTPLLLMALILVCGILLYAYTGHSLAASL* |
| Ga0153924_10188532 | 3300012089 | Attine Ant Fungus Gardens | MADQRNLDRRNDIRLLTPLLLMATILAFGILAYALTGHALAAGG* |
| Ga0181518_100588614 | 3300014156 | Bog | MANQRDIDHRNDVRFLTPLLLMALVLVIGILVYAYTGHAAAAIG* |
| Ga0163163_107870752 | 3300014325 | Switchgrass Rhizosphere | MANQRDIDRQNDTRFLTPLLPMATVLAVGILVYAFTGHAMPAAGSQTKG* |
| Ga0182015_104845552 | 3300014495 | Palsa | MQNQHDLDRTNDARFLTPLLLMAVILVCGILVYAYTGHALAAAG* |
| Ga0182024_1000311419 | 3300014501 | Permafrost | MPDQHHDRNQHDRNNDGRFLTPLLLMALIVAVGFLIYAYAGHALAG* |
| Ga0182024_1002543310 | 3300014501 | Permafrost | MPDQGDLDRRNDAHLLTPLLLMGLIIAAGILLYAYAGNAMAAAG* |
| Ga0182024_104436903 | 3300014501 | Permafrost | DRDRANDVRFLTPLLLMAVIVIAGILLYSYAGHALAV* |
| Ga0182024_106761842 | 3300014501 | Permafrost | MQNQQDLDRTNDARFLTPLLLMAVILVGGILVYAYTGHALAAAG* |
| Ga0182036_118019492 | 3300016270 | Soil | MADQRDLDRQNNMRLLTPLLLMATILAFGILAYALTGHALAAGG |
| Ga0187849_11238294 | 3300017929 | Peatland | MANQRDIDRRNDVRFLTPLLLMTLVLVIGILVYSYTVHAAAAIG |
| Ga0187814_102024671 | 3300017932 | Freshwater Sediment | MANQRDDVRFLTPLLLMALVLVIGILVYAYSGHATAESG |
| Ga0187854_102105692 | 3300017938 | Peatland | VPNQRDIDRRNEVRFLTPLLLMALVLVIGILVYAYTGHAAAAIG |
| Ga0187850_101027582 | 3300017941 | Peatland | MANQRDIDRRNDVRFLTPLLLMTLVLVIGILFYSYTVHAAAAIG |
| Ga0187819_100746555 | 3300017943 | Freshwater Sediment | IMANQRDIDRRNDVRFLTPLLLMALVLVIGILVYAYTGHATAASG |
| Ga0187819_102519212 | 3300017943 | Freshwater Sediment | MANQRDIDRRNDVRFLTPLLLMALVLVIGILVYSYTGHAAAAIG |
| Ga0187817_103145251 | 3300017955 | Freshwater Sediment | MANQRDIDRRNDVRFLTPLLLMALVLAIGILVYSYTGHAAAAIG |
| Ga0187817_103415853 | 3300017955 | Freshwater Sediment | AKPQKARTMASQRDIDRRNDVRFLTPLLLMALVLVIGILVYAYSGHATAESG |
| Ga0187817_105757281 | 3300017955 | Freshwater Sediment | MPNQRDIDRRNDVRFLTLLLLMALVLVIGILVYAYT |
| Ga0187817_109696542 | 3300017955 | Freshwater Sediment | MANQRGIDRRNDVRFLTPLLLMALVLVIGILVYSYTGHAAAAIG |
| Ga0187778_104814272 | 3300017961 | Tropical Peatland | MAEKGEIDRRNDVKFLTPLLLMALLLAGGILLYAYTGHALAAAG |
| Ga0187781_100013497 | 3300017972 | Tropical Peatland | VIVPNQPELDRNNDIKFLTPLLLMALILVCGMLLFAYSGHSLSQ |
| Ga0187781_109587302 | 3300017972 | Tropical Peatland | MANQRDLDRRNDMRFLTPLLLMAVILVIGILVYAYSGHALAAAGR |
| Ga0187781_112300871 | 3300017972 | Tropical Peatland | MSNQRDRDRANDARLLTPLLLMAAILAAGILLYAYTGHSLAAAG |
| Ga0187780_104949701 | 3300017973 | Tropical Peatland | KRMAEKGEIDRRNDVKFLTPLLLMAPLLAGGILLYAYTGHALAAAG |
| Ga0187816_102151992 | 3300017995 | Freshwater Sediment | MANQRDIDRRNDVRFLTPLLLMALVLVIGILVYAYTGHAAAAIG |
| Ga0187884_100073916 | 3300018009 | Peatland | MPNQRDIDRRNDVRFLTLLLLMALVLVIGILVYAYTGHAAAAIG |
| Ga0187874_100336488 | 3300018019 | Peatland | MPNQRDIDRRNDVRFLTLLLLMALVLVIGILVYAYTGH |
| Ga0187784_101689644 | 3300018062 | Tropical Peatland | MSNQRDRDRANDARLLTPLLLMAVILAAGIFLYAYTGHSLAAAG |
| Ga0187784_108368462 | 3300018062 | Tropical Peatland | MANQRDLDRRNDMRFLTPLLLMALILVIGILVYAYAGQGLAAPAS |
| Ga0187784_116341221 | 3300018062 | Tropical Peatland | MASQHDLDRRNDMRFLTSLLLMAVILVIGILVYAYSGHALAAAGR |
| Ga0187772_109467692 | 3300018085 | Tropical Peatland | MPNQHERNRSNDVKFLTQLLLMALILACGILLYAYTGHSLA |
| Ga0187772_113651082 | 3300018085 | Tropical Peatland | MAEKGEIDRRNDVKFLTPLLLMALLLACGILLYVYTGHALAAAG |
| Ga0187772_114359392 | 3300018085 | Tropical Peatland | MASQHDLDRRNDMRFLTPLLLMALILVIGILVYAYAGQGLAAPAS |
| Ga0187769_101515443 | 3300018086 | Tropical Peatland | MPNQRDIDRWNDVRFLTPLLLMALVLVIGILVYAYTGHAAAAIG |
| Ga0187769_105019662 | 3300018086 | Tropical Peatland | VQNPKVPAMANRRDLDRRNDARFLTPLLLMALILVIGILVYAYAGQGLAAPVR |
| Ga0187769_108805492 | 3300018086 | Tropical Peatland | MASQHDLDRRNDMRFLTPLLLMAVILVIGILVYAYSGHALAAAGR |
| Ga0187771_102040483 | 3300018088 | Tropical Peatland | MTNQSDLDRHNDMRFLTPLLLMALILVIGILVYAYAGQGLAAPVR |
| Ga0187770_108368803 | 3300018090 | Tropical Peatland | VQNPKVPAMANRRDLDRRNDARFLTPLLLMELILVIGILVYAYSGQSLAAIG |
| Ga0210385_102154421 | 3300021402 | Soil | MPNQRDRDRVNDAHFLTPLLLIAVIVACGILLYAYTGHALATAG |
| Ga0210394_1000072324 | 3300021420 | Soil | MANQRDRDRVNDAHFLTPLLLIAVIVACGILLYAYTGHALATAG |
| Ga0210394_101932925 | 3300021420 | Soil | MPNQRDRDRVNDANFLTPLLLIAVIVACGILLYAYTGHALATAG |
| Ga0212123_1001019820 | 3300022557 | Iron-Sulfur Acid Spring | MPGAMLNRRDLDRKNDIRLLTPLLLMAAILAAGILIYAYTGHSLAAAG |
| Ga0208323_10669742 | 3300025439 | Peatland | MPNQRDIDRRNDVRFLTPLLLMTLVLVIGILVYSYTVHAAAAIG |
| Ga0208819_10470801 | 3300025498 | Peatland | MANQRDIDRRNDVRFLTPLLLMALVLVIGILFYSYTGHAAAAIG |
| Ga0207671_105994261 | 3300025914 | Corn Rhizosphere | MTSQQDRRYDMCLLMPLLLMATLLAFGILAFAVTGHALAAGG |
| Ga0207644_100067351 | 3300025931 | Switchgrass Rhizosphere | MTSQQDRRYDMRLLMPLLLMATLLAFGILAFAVTGHAL |
| Ga0208042_10728123 | 3300027568 | Peatlands Soil | DRRNDVRFLTPLLLMALVLVIGILFYSYTGHAAAAIG |
| Ga0209060_102942471 | 3300027826 | Surface Soil | MPSRRDSDRRNDARFLTPLLLMALLMLCGILVYVYTGHPLA |
| Ga0209517_101634913 | 3300027854 | Peatlands Soil | MPNQRDIDRRNDVRFLTPLLLMALVLVIGILVYVYTGHAAAAIG |
| Ga0209624_109344421 | 3300027895 | Forest Soil | DRVNDAHFLTPLLLIAVIVACGILLYAYTGHALATAG |
| Ga0316363_102203321 | 3300030659 | Peatlands Soil | RDIDRRNDVRFLTPLLLMALVLVIGILVYAYTGHAAAAIG |
| Ga0310686_1005396302 | 3300031708 | Soil | MPNQRDRDRANDIHFLTPLLLIAVIVACGILLYAYTGHALAMAG |
| Ga0310686_1119044903 | 3300031708 | Soil | MPKRNDLDRQNDARLLTGLLLMATILACAILVYAYTGHPLAAGG |
| Ga0307478_100356624 | 3300031823 | Hardwood Forest Soil | MPEQRDLDRTNDMRFLTPLLVMAVIVVCGILLYAYGGHALAAAG |
| Ga0306925_103921453 | 3300031890 | Soil | MADQRDLDRRDDMRLLTPLLLVATILAFGILAYALTGHALAAGG |
| Ga0306923_108172681 | 3300031910 | Soil | MASQQDFDRRNDMRLLTPLLLMATILALGILVYALTGHAIAAGG |
| Ga0306926_129799251 | 3300031954 | Soil | MASQQDFDRRNDMRLLTPLLLMATILALGILVYALTGHAIA |
| Ga0306924_106222373 | 3300032076 | Soil | MADQRDLDRRNDMRLLTPLRLMATILAFGILAYALTGHALAAGG |
| Ga0311301_103618372 | 3300032160 | Peatlands Soil | MANQRDIERRNDIRFLTPRLLIALVLVIGILLYAYTGHAAAAIG |
| Ga0311301_108360561 | 3300032160 | Peatlands Soil | RDIDRRNDVRFLTPLLLMALVLVIGILVYSYTGHAAAAIG |
| Ga0335085_1001430816 | 3300032770 | Soil | MPNQRDIDRRNDAKFLTPPLLMAALLACGILLYAYTGHASAMPGYGSI |
| Ga0335079_106954712 | 3300032783 | Soil | MPNQNDLDHRNDVRLLTPLLLMAAILAVGVLIYAYTGHALAAAS |
| Ga0335079_113977172 | 3300032783 | Soil | MPNQHDFDRKNDVKFLTPLLLMALVLACGVLLYAYTGHSLAASP |
| Ga0335078_100474926 | 3300032805 | Soil | MSNQHELDRKNDVKFLTPLLLMALILACGVLLYAYSGYSLAASPA |
| Ga0335078_100731892 | 3300032805 | Soil | MPTQHDLDRRNDGRFLTPLLLMAVILAMSVLVYVCNGHA |
| Ga0335078_103912953 | 3300032805 | Soil | MPNQRDLDRRNDTRFLTPLLIMALILAIGILVYAYSGQSLAGAG |
| Ga0335078_106597332 | 3300032805 | Soil | MPNQSDIDRRNDVRFLTPLLLMALVLVIGILVYAYTGHAAAAIG |
| Ga0335078_107848971 | 3300032805 | Soil | MPNQHELDRKNDAKFLTPLLLMALILACGVLLFAYAGYSLAASP |
| Ga0335078_111329672 | 3300032805 | Soil | MVRTVPYQDNRNRKNDIRFLTPLLLMAAILAVGILLFGYAGHALAAAVA |
| Ga0335078_120894722 | 3300032805 | Soil | MPYHHDLDRKNDIRLLTPLLLMAAILALGVLVYAYTGHALAAPG |
| Ga0335081_104780672 | 3300032892 | Soil | QHDFDRKNDVKFLTPLLLMALVLACGVLLYAYTGHSLAASP |
| Ga0335074_101200203 | 3300032895 | Soil | MPNQHERNRSNDVKFLTPLLLMALILACGILLYAYTGHSLAASL |
| Ga0335074_101497733 | 3300032895 | Soil | MPYQDDSDRRNDIRLLTPLLLMAVIIAVGVLIWAYTGHALAAGG |
| Ga0335074_104297423 | 3300032895 | Soil | MPDQHDLDRRNDMRLLTPLLLMAAIIALGILVFAYTGHSLAATR |
| Ga0335075_102579721 | 3300032896 | Soil | MAYHRNDLDRKNDIRLLTPLLLMAAILAVGILIYALTGHSLAA |
| Ga0335075_103577291 | 3300032896 | Soil | MPYHRNDLDRKNDIRLLTPLLLMAAILAVGILIYALTGHSLAASL |
| Ga0335075_105036612 | 3300032896 | Soil | MPTQHDLDRRNDMRLLTPLLLMAVILAMGILLYLCNGHGV |
| Ga0335075_105376612 | 3300032896 | Soil | MPDQSHRHHQTDRDRRNDIRFVTPFLLMATILAVGILIYAYAGHALAAGA |
| Ga0335077_1002175014 | 3300033158 | Soil | MPNQHDLDHRNDVRLLTPLLLMAAILAVGVLIYAYTGHALAAAS |
| Ga0335077_115593392 | 3300033158 | Soil | MPNQRDIDRENDIRFMTPLLLMGLILVCGILAYAYTGHPLGAG |
| ⦗Top⦘ |