


| Basic Information | |
|---|---|
| Family ID | F096513 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDV |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 22.33 % |
| % of genes near scaffold ends (potentially truncated) | 25.96 % |
| % of genes from short scaffolds (< 2000 bps) | 78.85 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.462 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.654 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.462 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.25% β-sheet: 0.00% Coil/Unstructured: 65.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 34.62 |
| PF13180 | PDZ_2 | 7.69 |
| PF00441 | Acyl-CoA_dh_1 | 7.69 |
| PF13620 | CarboxypepD_reg | 3.85 |
| PF02771 | Acyl-CoA_dh_N | 2.88 |
| PF10459 | Peptidase_S46 | 0.96 |
| PF01381 | HTH_3 | 0.96 |
| PF02770 | Acyl-CoA_dh_M | 0.96 |
| PF01264 | Chorismate_synt | 0.96 |
| PF13193 | AMP-binding_C | 0.96 |
| PF08281 | Sigma70_r4_2 | 0.96 |
| PF04264 | YceI | 0.96 |
| PF13485 | Peptidase_MA_2 | 0.96 |
| PF00150 | Cellulase | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 11.54 |
| COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 0.96 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.96 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.96 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.42 % |
| Unclassified | root | N/A | 10.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100667107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2233 | Open in IMG/M |
| 3300000956|JGI10216J12902_102856916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1072 | Open in IMG/M |
| 3300000956|JGI10216J12902_105165139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1351 | Open in IMG/M |
| 3300000956|JGI10216J12902_105745906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1704 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_103660154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 855 | Open in IMG/M |
| 3300003320|rootH2_10132834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3598 | Open in IMG/M |
| 3300003322|rootL2_10023267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1864 | Open in IMG/M |
| 3300003323|rootH1_10023020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1123 | Open in IMG/M |
| 3300003323|rootH1_10027013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1835 | Open in IMG/M |
| 3300003323|rootH1_10057013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1998 | Open in IMG/M |
| 3300003323|rootH1_10274425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 2998 | Open in IMG/M |
| 3300004463|Ga0063356_100086855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3333 | Open in IMG/M |
| 3300005337|Ga0070682_100010793 | All Organisms → cellular organisms → Bacteria | 5196 | Open in IMG/M |
| 3300005337|Ga0070682_100259445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1257 | Open in IMG/M |
| 3300005337|Ga0070682_100388486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1052 | Open in IMG/M |
| 3300005345|Ga0070692_10575585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 741 | Open in IMG/M |
| 3300005367|Ga0070667_101393697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 657 | Open in IMG/M |
| 3300005539|Ga0068853_102312437 | Not Available | 521 | Open in IMG/M |
| 3300005577|Ga0068857_101471543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 663 | Open in IMG/M |
| 3300005617|Ga0068859_100114342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2763 | Open in IMG/M |
| 3300005719|Ga0068861_102427804 | Not Available | 527 | Open in IMG/M |
| 3300005841|Ga0068863_100157863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2172 | Open in IMG/M |
| 3300005944|Ga0066788_10013501 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300009093|Ga0105240_10340540 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1704 | Open in IMG/M |
| 3300009100|Ga0075418_11499287 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → Taphrinomycotina → Taphrinomycotina incertae sedis → Saitoella → Saitoella complicata → Saitoella complicata NRRL Y-17804 | 732 | Open in IMG/M |
| 3300009448|Ga0114940_10134958 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300009551|Ga0105238_11319805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 748 | Open in IMG/M |
| 3300009695|Ga0123337_10083347 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300010038|Ga0126315_11216584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 512 | Open in IMG/M |
| 3300010397|Ga0134124_10796448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 944 | Open in IMG/M |
| 3300010397|Ga0134124_12177157 | Not Available | 594 | Open in IMG/M |
| 3300012212|Ga0150985_102431583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 507 | Open in IMG/M |
| 3300012212|Ga0150985_104317865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 728 | Open in IMG/M |
| 3300012212|Ga0150985_109428134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 766 | Open in IMG/M |
| 3300012212|Ga0150985_110171497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 634 | Open in IMG/M |
| 3300012212|Ga0150985_114628543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 781 | Open in IMG/M |
| 3300012469|Ga0150984_101111227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 774 | Open in IMG/M |
| 3300012469|Ga0150984_102203522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 717 | Open in IMG/M |
| 3300012469|Ga0150984_104041597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1307 | Open in IMG/M |
| 3300012469|Ga0150984_108407003 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300012469|Ga0150984_109269589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1303 | Open in IMG/M |
| 3300012469|Ga0150984_111286905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 551 | Open in IMG/M |
| 3300012469|Ga0150984_112932145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 653 | Open in IMG/M |
| 3300012891|Ga0157305_10010882 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300012900|Ga0157292_10005380 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 2605 | Open in IMG/M |
| 3300012900|Ga0157292_10026905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1420 | Open in IMG/M |
| 3300012929|Ga0137404_10563887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1021 | Open in IMG/M |
| 3300012930|Ga0137407_10388502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1291 | Open in IMG/M |
| 3300012943|Ga0164241_10000315 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 101885 | Open in IMG/M |
| 3300012943|Ga0164241_10002595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 19198 | Open in IMG/M |
| 3300012985|Ga0164308_10025917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3503 | Open in IMG/M |
| 3300014325|Ga0163163_11563094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 721 | Open in IMG/M |
| 3300014969|Ga0157376_10619854 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300015264|Ga0137403_10434117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1190 | Open in IMG/M |
| 3300018422|Ga0190265_10830792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1047 | Open in IMG/M |
| 3300018432|Ga0190275_10094766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 2629 | Open in IMG/M |
| 3300018890|Ga0193595_1153644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 622 | Open in IMG/M |
| 3300020034|Ga0193753_10303503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 685 | Open in IMG/M |
| 3300020203|Ga0163148_10527739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 534 | Open in IMG/M |
| 3300021181|Ga0210388_10022033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 5170 | Open in IMG/M |
| 3300021404|Ga0210389_10179598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1647 | Open in IMG/M |
| 3300021475|Ga0210392_10228207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1311 | Open in IMG/M |
| (restricted) 3300021517|Ga0224723_1039383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1748 | Open in IMG/M |
| 3300022512|Ga0242676_1052931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 510 | Open in IMG/M |
| 3300022512|Ga0242676_1056009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 501 | Open in IMG/M |
| 3300022561|Ga0212090_10156767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2025 | Open in IMG/M |
| 3300022878|Ga0247761_1001107 | All Organisms → cellular organisms → Bacteria | 4905 | Open in IMG/M |
| 3300022894|Ga0247778_1117540 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300022904|Ga0247769_1038016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1326 | Open in IMG/M |
| 3300022908|Ga0247779_1040847 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1231 | Open in IMG/M |
| 3300023265|Ga0247780_1102782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 750 | Open in IMG/M |
| 3300024288|Ga0179589_10507409 | Not Available | 560 | Open in IMG/M |
| 3300025913|Ga0207695_10237784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1723 | Open in IMG/M |
| 3300025924|Ga0207694_11221327 | Not Available | 636 | Open in IMG/M |
| 3300026088|Ga0207641_10116872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2374 | Open in IMG/M |
| 3300026088|Ga0207641_10178028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1946 | Open in IMG/M |
| 3300026116|Ga0207674_11878316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 565 | Open in IMG/M |
| 3300026215|Ga0209849_1021046 | Not Available | 1102 | Open in IMG/M |
| 3300028652|Ga0302166_10030172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1090 | Open in IMG/M |
| 3300028741|Ga0302256_10053251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1036 | Open in IMG/M |
| 3300028802|Ga0307503_10035531 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Dictyostelia → Acytosteliales → Acytosteliaceae → Heterostelium → Heterostelium album → Heterostelium album PN500 | 1791 | Open in IMG/M |
| 3300029989|Ga0311365_10298647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1391 | Open in IMG/M |
| 3300030294|Ga0311349_10394043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1310 | Open in IMG/M |
| 3300030294|Ga0311349_11516941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 622 | Open in IMG/M |
| 3300031231|Ga0170824_126333425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 706 | Open in IMG/M |
| 3300031231|Ga0170824_127884410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 659 | Open in IMG/M |
| 3300031232|Ga0302323_100288216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1698 | Open in IMG/M |
| 3300031232|Ga0302323_101889162 | Not Available | 677 | Open in IMG/M |
| 3300031232|Ga0302323_103475141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 501 | Open in IMG/M |
| 3300031456|Ga0307513_10133403 | Not Available | 2424 | Open in IMG/M |
| 3300031456|Ga0307513_10240009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1618 | Open in IMG/M |
| 3300031616|Ga0307508_10002662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 18732 | Open in IMG/M |
| 3300031616|Ga0307508_10105721 | All Organisms → cellular organisms → Bacteria | 2413 | Open in IMG/M |
| 3300031616|Ga0307508_10554049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 748 | Open in IMG/M |
| 3300031726|Ga0302321_101163868 | Not Available | 883 | Open in IMG/M |
| 3300031730|Ga0307516_10010475 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10185 | Open in IMG/M |
| 3300031902|Ga0302322_100430930 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
| 3300031918|Ga0311367_10231044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1931 | Open in IMG/M |
| 3300032144|Ga0315910_11437835 | Not Available | 538 | Open in IMG/M |
| 3300032157|Ga0315912_10360832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1148 | Open in IMG/M |
| 3300033417|Ga0214471_10015137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 6065 | Open in IMG/M |
| 3300033475|Ga0310811_10324668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 1750 | Open in IMG/M |
| 3300033475|Ga0310811_10877786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 816 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.46% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 10.58% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 6.73% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 5.77% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 5.77% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 5.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 4.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.85% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.88% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 1.92% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.92% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.96% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.96% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.96% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.96% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300003320 | Sugarcane root Sample H2 | Host-Associated | Open in IMG/M |
| 3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
| 3300003323 | Sugarcane root Sample H1 | Host-Associated | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009448 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek Source | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009695 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - frozenSSSS metaG | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018890 | Soil crust microbial communities from Colorado Plateau, Utah, USA - mid-late stage, bundles v1 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020203 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP7.P2 | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021517 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR2_MetaG | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022561 | Borup_combined assembly | Environmental | Open in IMG/M |
| 3300022878 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L111-311C-4 | Environmental | Open in IMG/M |
| 3300022894 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5 | Environmental | Open in IMG/M |
| 3300022904 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L166-409R-6 | Environmental | Open in IMG/M |
| 3300022908 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5 | Environmental | Open in IMG/M |
| 3300023169 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L081-202R-4 | Environmental | Open in IMG/M |
| 3300023265 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L079-202R-5 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300028741 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1006671072 | 3300000364 | Soil | MVESGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDI* |
| JGI10216J12902_1028569162 | 3300000956 | Soil | MVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKNEPKDNFDDLV* |
| JGI10216J12902_1051651392 | 3300000956 | Soil | MVEPGLVTLTKIVGTLLLAMGIIPFLFLLAPGGDRAEPKDNFDDLNN* |
| JGI10216J12902_1057459064 | 3300000956 | Soil | MVEPGLVTLAKIVGTILLAMGVIPFLFLLSPGGDKSEPKENFDDLV* |
| JGIcombinedJ13530_1036601541 | 3300001213 | Wetland | MVEPGLVTLAKIVGTLLLAMGVIPFLFLLSPGGDKSEPKDNFDDLV* |
| rootH2_101328343 | 3300003320 | Sugarcane Root And Bulk Soil | MARAGYRPGAMVEPGLVTLAKIVGTLLLCMGIIPFTFLLAPGDTSEPEPSDTFDGD* |
| rootL2_100232673 | 3300003322 | Sugarcane Root And Bulk Soil | MVEPGLVTLTKIVGTLLLAMGIIPFMFLLSSGGDKAEPKDNFDDLI* |
| rootH1_100230202 | 3300003323 | Sugarcane Root And Bulk Soil | MVEPGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDV* |
| rootH1_100270132 | 3300003323 | Sugarcane Root And Bulk Soil | MARAGYRPGAMVEPGIVTLAKIVGTLLLCMGIIPFTFLLSPGDTSEPDPSDTFDGD* |
| rootH1_100570132 | 3300003323 | Sugarcane Root And Bulk Soil | MVEPGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDI* |
| rootH1_102744252 | 3300003323 | Sugarcane Root And Bulk Soil | MVEPGLVTLAKIVGTLLVAMGVIPFLFLLSPGGDKSEPSDNFDDIN* |
| Ga0063356_1000868552 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MVEPGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDLNN* |
| Ga0070682_1000107931 | 3300005337 | Corn Rhizosphere | MVEPGIVTLAKIVGTLLFCMGVVPFLFLLAPGDRKEPEVKDTFDGDVQ* |
| Ga0070682_1002594452 | 3300005337 | Corn Rhizosphere | MVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDI* |
| Ga0070682_1003884861 | 3300005337 | Corn Rhizosphere | YRGDPMVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDLV* |
| Ga0070692_105755852 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MVEPGLITLTKIVGTLLLAMGVIPFLFLLSSGGDKSEPKDNFDDI* |
| Ga0070667_1013936972 | 3300005367 | Switchgrass Rhizosphere | MVRAMVEPGLVTLAKIVGTLLLAMGVIPFLFLLSPGGDKSEPKENFDDL* |
| Ga0068853_1023124372 | 3300005539 | Corn Rhizosphere | MVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDV* |
| Ga0068857_1014715431 | 3300005577 | Corn Rhizosphere | MVEPGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDLN* |
| Ga0068859_1001143423 | 3300005617 | Switchgrass Rhizosphere | MVEPGLVTLTKIVGTLLLAMGIIPFLFLLSSGGDKSEPKDNFDDV* |
| Ga0068861_1024278041 | 3300005719 | Switchgrass Rhizosphere | MVEPGLVTLAKIIGTLLGAMAVVPFLFLLAPGDRSEPELKDTFD |
| Ga0068863_1001578633 | 3300005841 | Switchgrass Rhizosphere | MVEPGIVTLAKIVGTLLVAMGIVPFLFLLAPGDRSEPDVKDTFDGDVQ* |
| Ga0066788_100135013 | 3300005944 | Soil | MVESGFVTLTKIVGTLLLCMGIIPFLFLLAPGDRTEPEETFDGD* |
| Ga0105240_103405403 | 3300009093 | Corn Rhizosphere | MVEPGLVTLAKIVGTLLLCMGIIPFTFLLSPGDTSEPDPSDTFDGD* |
| Ga0075418_114992872 | 3300009100 | Populus Rhizosphere | MVEAGLLTLAKIVGTLLAAMGIIPLVFLMAPGDSSEPKDTFDEH* |
| Ga0114940_101349583 | 3300009448 | Groundwater | MVEPGLVTLAKIVGTLLFAMGVVPFLFLLAPGDRSEPEVKDTFDGDVQ* |
| Ga0105238_113198052 | 3300009551 | Corn Rhizosphere | MVEPGLVTLAKIVGTLLCAMGVIPFLFLLSPGGDKAEPKDNFDDLN* |
| Ga0123337_100833471 | 3300009695 | Glacier Valley | MVEPGIVTLVKIVGTLLLAMGIVPFLFLLAPGDRSEPEVKDTFDGDVQ* |
| Ga0126315_112165841 | 3300010038 | Serpentine Soil | MVEPGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKAEPKDNFDDI* |
| Ga0134124_107964481 | 3300010397 | Terrestrial Soil | MVEPGLVTLAKIVGTLLLAMGIIPFMFLLSKGGDKSEPKDNFDDLI* |
| Ga0134124_121771571 | 3300010397 | Terrestrial Soil | MVEPGIVTLAKIVGTLLFCMGVVPFLFLLAPGDRKEPDVKDTFDGDVQ* |
| Ga0150985_1024315831 | 3300012212 | Avena Fatua Rhizosphere | PGLVTLAKIVGTLLLSMGIIPFLFLLTPGSDKSEPKDNFDDI* |
| Ga0150985_1043178651 | 3300012212 | Avena Fatua Rhizosphere | PGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDLV* |
| Ga0150985_1094281341 | 3300012212 | Avena Fatua Rhizosphere | GIVTLAKIVGTLLFAMSVVPFLFLLAPGDRSEPEVKDTFDGDVQ* |
| Ga0150985_1101714971 | 3300012212 | Avena Fatua Rhizosphere | EHGLVTLTKIVGTLLLSMGIIPFLFLLSSGGDKSEPKDNFDDI* |
| Ga0150985_1146285431 | 3300012212 | Avena Fatua Rhizosphere | GLVTLTKIVGTLLLAMGIIPFLFLLSSGGDKSEPKDNFDDI* |
| Ga0150984_1011112271 | 3300012469 | Avena Fatua Rhizosphere | KIVGTLLLAMGIIPFMFLLSPGGDKSEPKDNFDDI* |
| Ga0150984_1022035222 | 3300012469 | Avena Fatua Rhizosphere | PGLVTLAKIVGTLLVAMGIVPFLFLLAPGDRSEPEVKDTFDGDVQ* |
| Ga0150984_1040415971 | 3300012469 | Avena Fatua Rhizosphere | EPGLVTLAKIVGTLLLAMGIIPFLFLLSSGGDRAEPKENFDDV* |
| Ga0150984_1084070031 | 3300012469 | Avena Fatua Rhizosphere | PGLVTLTKIVGTLLLAMGIIPFMFLLSSGGDKAEPKDNFDDLV* |
| Ga0150984_1092695891 | 3300012469 | Avena Fatua Rhizosphere | LAKIVGTLLLAMGVIPFLFLLSSGGDKSEPKDNFDDI* |
| Ga0150984_1112869051 | 3300012469 | Avena Fatua Rhizosphere | PGLVTLAKIVGTLLVAMSVVPFLFLLAPGDRTEPETKDTFDGDVQ* |
| Ga0150984_1129321451 | 3300012469 | Avena Fatua Rhizosphere | GIVTLAKIVGTLLVAMGIVPFLFLLAPGDRSEPDVKDTFDGDVQ* |
| Ga0157305_100108823 | 3300012891 | Soil | MVEPGLVTLAKIIGTLLGAMAVVPFLFLLAPGDRSEPELKDTFDGDVQ* |
| Ga0157292_100053802 | 3300012900 | Soil | MVEPGLVTLAKIVGTLLFAMSVVPFLFLLARGDRTEPDVKDTFDGDVQ* |
| Ga0157292_100269052 | 3300012900 | Soil | MVEPGIVTLAKIVGTLLCAMSVVAVLFLLAPGDRSEPELKDTFDGDVQ* |
| Ga0137404_105638872 | 3300012929 | Vadose Zone Soil | MVESGLITLTKIVGTLLLAMGVIPFLFLLSPGGDKSEPKDNFDDI* |
| Ga0137407_103885021 | 3300012930 | Vadose Zone Soil | VESGLITLTKIVGTLLLAMGVIPFLFLLSPGGDKSEPKDNFDDI* |
| Ga0164241_1000031540 | 3300012943 | Soil | MVEPGLVTLAKIVGTLLGAMGVIPFLFLLSSGGDKAEPKDNFEDLN* |
| Ga0164241_1000259513 | 3300012943 | Soil | MVEPGLVTLAKIVGTLLLAMGVIPFLFLLSSGGDKSEPKDNFDDLV* |
| Ga0164308_100259175 | 3300012985 | Soil | MVESGLITLTKIVGTILLAMGVIPFMFLLSKGGDKSEPKDNFDDLI* |
| Ga0163163_115630942 | 3300014325 | Switchgrass Rhizosphere | MVEPGLVTLAKIVGTLLLAMGIIPFMFLLSSGGDKSEPKENFDDIN* |
| Ga0157376_106198543 | 3300014969 | Miscanthus Rhizosphere | MVEPGLVTLAKIVGTLLFCMGVVPFLFLLAPGDRKEPEVKDTFDGDVQ* |
| Ga0137403_104341173 | 3300015264 | Vadose Zone Soil | MVEPGLVTLTKIVGTLLLAMGIIPFMFLLSKGGDRS |
| Ga0190265_108307922 | 3300018422 | Soil | MVEPGLVTLAKIVGTILLAMGIIPFIFMLSAGGDRAEPKENFDDLN |
| Ga0190275_100947662 | 3300018432 | Soil | MVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKNEPKDNFDDLV |
| Ga0193595_11536441 | 3300018890 | Soil | MVEPGLVTLAKIVGTLLLGMGIIPFLFLLSPGGDKSEPK |
| Ga0193753_103035032 | 3300020034 | Soil | MVESGLVTLTKIVGTLLLAMGIIPFMFLLSKDGDKSEPKDNFDDV |
| Ga0163148_105277391 | 3300020203 | Freshwater Microbial Mat | LVTLAKIVGTLLIAMGIIPFLFLLSPGGDKSEPKDHFEDL |
| Ga0210388_100220333 | 3300021181 | Soil | MVEPGIVTLAKIVGTLLFCAGVIPFIFLLVPGDRSEPTDTFDGD |
| Ga0210389_101795982 | 3300021404 | Soil | MVEPGIVTLAKIVGTLLFCMGIIPFTFLLAPGEKSEPDAKDTFDGD |
| Ga0210392_102282073 | 3300021475 | Soil | AKIVGTLLLCMGIIPFLFLLAPGDRTEPKDTFDGD |
| (restricted) Ga0224723_10393833 | 3300021517 | Freshwater Sediment | MVEPGVVTLTKIVGTLLLAMGIIPFLFLLAPGSDSSEPKDTFDEH |
| Ga0242676_10529311 | 3300022512 | Soil | PGIVTLAKIVGTLLFCAGVIPFIFLLVPGDRSEPTDTFDGD |
| Ga0242676_10560091 | 3300022512 | Soil | GFVTLTKIVGTLLLCMGIIPFLFLLAPGDRTEPKDSFDGD |
| Ga0212090_101567673 | 3300022561 | Glacier Valley | MVEPGIVTLVKIVGTLLLAMGIVPFLFLLAPGDRSEPEVKDTFDGDVQ |
| Ga0247761_10011075 | 3300022878 | Plant Litter | MVEPGIVTLAKIVGTLLFAMGVVPFLFLLAPGDRKEPEVKDTFDGDVQ |
| Ga0247778_11175401 | 3300022894 | Plant Litter | MVEPGLVTLAKIIGTLLGAMAVVPFLFLLAPGDRSEPELKDTFDGDVQ |
| Ga0247769_10380162 | 3300022904 | Plant Litter | MVEPGIVTLAKIVGTLLFAMGVVPFLFLLAPGDRSEPEVKDTFDGDVQ |
| Ga0247779_10408472 | 3300022908 | Plant Litter | MVEPGIVTLAKIVGTLLFCMGVVPFLFLLAPGDRKEPDVKDTFDGDVQ |
| Ga0247762_10052124 | 3300023169 | Plant Litter | MVEPGLVTLAKIIGTLLFAMGTIPVLFLLAPGDSSEPTDRLDSEHKG |
| Ga0247780_11027822 | 3300023265 | Plant Litter | VTLAKIVGTLLCAMSVVPFLFLLAPGDRSEPELKDTFDGDVQ |
| Ga0179589_105074092 | 3300024288 | Vadose Zone Soil | MVESGLITLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDI |
| Ga0207695_102377842 | 3300025913 | Corn Rhizosphere | MVEPGLVTLAKIVGTLLLCMGIIPFTFLLSPGDTSEPDPSDTFDGD |
| Ga0207694_112213272 | 3300025924 | Corn Rhizosphere | MVEPGLVTLAKIVGTLLCAMGVIPFLFLLSPGGDKAEPKDNFDDLN |
| Ga0207641_101168723 | 3300026088 | Switchgrass Rhizosphere | MVEPGIVTLAKIVGTLLVAMGIVPFLFLLAPGDRSEPDVKDTFDGDVQ |
| Ga0207641_101780282 | 3300026088 | Switchgrass Rhizosphere | MVEPGLITLTKIVGTLLLAMGVIPFLFLLSSGGDKSEPKDNFDDI |
| Ga0207674_118783161 | 3300026116 | Corn Rhizosphere | MVEPGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDLN |
| Ga0209849_10210462 | 3300026215 | Soil | MVESGFVTLTKIVGTLLLCMGIIPFLFLLAPGDRTEPEETFDGD |
| Ga0302166_100301722 | 3300028652 | Fen | MVEPGLVTLAKIVGTLLLGMSIVPFLFLLAPGDRTEPDAKDSFDGDV |
| Ga0302256_100532511 | 3300028741 | Fen | AMVEPGLVTLAKIVGTLLLGMSIVPFLFLLAPGDRTEPDAKDSFDGDV |
| Ga0307503_100355312 | 3300028802 | Soil | MVEHGLVTLTKIVGTLLLAMGVIPFLFLLSPGGDKSEPKDNFDDI |
| Ga0311365_102986472 | 3300029989 | Fen | MVEPGLVTLAKIVGTLLLGMSIVPFLFLLAPGDRTVPDPKDTFDGDVL |
| Ga0311349_103940433 | 3300030294 | Fen | VEPGIVTLAKIVGTLLCAMGVVPFLFLLAPGDRKEPEVKDTFDGDVQ |
| Ga0311349_115169412 | 3300030294 | Fen | TLAKIVGTLLVAMGIVPFLFLLAPGDRSEPETKDTFDGDVQ |
| Ga0170824_1263334251 | 3300031231 | Forest Soil | MVEPGLVTLAKIVGTLLLAMGVIPFLFLLSPGGDKAEPKDNFDDI |
| Ga0170824_1278844101 | 3300031231 | Forest Soil | GLVTLAKIVGTLLLSMGIIPFVFLLAPGERKEPTDTFDGD |
| Ga0302323_1002882162 | 3300031232 | Fen | MVEPGIVTLAKIVGTLLCAMGVVPFLFLLAPGDRKEPEVKDTFDGDVQ |
| Ga0302323_1018891622 | 3300031232 | Fen | MVEPGLVTLAKIVGTLLFCMGVVPFLFLLAPGDRKEPEVKDTFDGDVQ |
| Ga0302323_1034751411 | 3300031232 | Fen | MVEPGLVTLAKIVGTLLLAMGVIPFLFLLSPGGDKSEPKDNFEDLN |
| Ga0307513_101334032 | 3300031456 | Ectomycorrhiza | MVEPGLVTLAKIVGTLLFAMGVVPFLFLLAPGDRKEPETKDTFDGDVQ |
| Ga0307513_102400092 | 3300031456 | Ectomycorrhiza | MVEPGLVTLAKIVGTLLLAMGIVPFLFLLAPGDRTEPEVKDTFDGDVQ |
| Ga0307508_1000266215 | 3300031616 | Ectomycorrhiza | MVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKAEPKDNFDDI |
| Ga0307508_101057212 | 3300031616 | Ectomycorrhiza | MVEPGFVTLAKIVGTLLLCMGIIPFLFLLAPGDRSEPNETFDGD |
| Ga0307508_105540492 | 3300031616 | Ectomycorrhiza | MVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKAEPK |
| Ga0302321_1011638682 | 3300031726 | Fen | MPEPGLVTLVKIVGTLLAAMGVVPFLFLLAPGDRKEPNETFDGDVQ |
| Ga0307516_100104752 | 3300031730 | Ectomycorrhiza | MVESGLVTLAKIVGTLLLAMGVIPFLFLLSPGGDRAEPKDNFDDI |
| Ga0302322_1004309303 | 3300031902 | Fen | MPEPGLVTLVKIVGTLLAAMGVAFLFLLAPGDRKEPNETFDGDVQ |
| Ga0311367_102310441 | 3300031918 | Fen | VGTLLLGMSIVPFLFLLAPGDRTEPDAKDSFDGDV |
| Ga0315910_114378352 | 3300032144 | Soil | MVEPGLVTLAKIVGTLLLAMGIIPFLFLLSPGGDKTEPKENFDDI |
| Ga0315912_103608323 | 3300032157 | Soil | MVEPGIVTLAKIVGTLLFAMGVIPFLFLAAPGDRTEPEVKDTFDGDVQ |
| Ga0214471_100151374 | 3300033417 | Soil | VEAGLLTLAKIVGTLVISIGIVPLLFLLAPGDRGEPDDTFTPGV |
| Ga0310811_103246684 | 3300033475 | Soil | MVEPGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDIN |
| Ga0310811_108777862 | 3300033475 | Soil | MVESGLVTLTKIVGTLLLAMGIIPFLFLLSPGGDKSEPKDNFDDLN |
| ⦗Top⦘ |