


| Basic Information | |
|---|---|
| Family ID | F096479 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 44 residues |
| Representative Sequence | KFTIYNLTDQHNLTNDIPFYGNDFLTRQPPRSYDLTLSGKF |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.15 % |
| % of genes from short scaffolds (< 2000 bps) | 86.54 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (50.962 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (25.961 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.615 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (38.462 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00962 | A_deaminase | 12.50 |
| PF00576 | Transthyretin | 7.69 |
| PF00860 | Xan_ur_permease | 5.77 |
| PF01229 | Glyco_hydro_39 | 3.85 |
| PF06516 | NUP | 2.88 |
| PF09957 | VapB_antitoxin | 1.92 |
| PF00294 | PfkB | 1.92 |
| PF01979 | Amidohydro_1 | 1.92 |
| PF03561 | Allantoicase | 1.92 |
| PF09335 | SNARE_assoc | 1.92 |
| PF00111 | Fer2 | 1.92 |
| PF01799 | Fer2_2 | 1.92 |
| PF02738 | MoCoBD_1 | 1.92 |
| PF07690 | MFS_1 | 1.92 |
| PF04973 | NMN_transporter | 1.92 |
| PF13085 | Fer2_3 | 0.96 |
| PF00383 | dCMP_cyt_deam_1 | 0.96 |
| PF01522 | Polysacc_deac_1 | 0.96 |
| PF01156 | IU_nuc_hydro | 0.96 |
| PF13570 | PQQ_3 | 0.96 |
| PF12146 | Hydrolase_4 | 0.96 |
| PF01887 | SAM_HAT_N | 0.96 |
| PF04115 | Ureidogly_lyase | 0.96 |
| PF00393 | 6PGD | 0.96 |
| PF00004 | AAA | 0.96 |
| PF00593 | TonB_dep_Rec | 0.96 |
| PF03575 | Peptidase_S51 | 0.96 |
| PF05638 | T6SS_HCP | 0.96 |
| PF02133 | Transp_cyt_pur | 0.96 |
| PF16732 | ComP_DUS | 0.96 |
| PF12002 | MgsA_C | 0.96 |
| PF13487 | HD_5 | 0.96 |
| PF00510 | COX3 | 0.96 |
| PF08530 | PepX_C | 0.96 |
| PF01370 | Epimerase | 0.96 |
| PF01425 | Amidase | 0.96 |
| PF00941 | FAD_binding_5 | 0.96 |
| PF06262 | Zincin_1 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 12.50 |
| COG2351 | 5-hydroxyisourate hydrolase (purine catabolism), transthyretin-related family | Nucleotide transport and metabolism [F] | 7.69 |
| COG3664 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 3.85 |
| COG5042 | Purine nucleoside permease | Nucleotide transport and metabolism [F] | 2.88 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 1.92 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 1.92 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 1.92 |
| COG4266 | Allantoicase | Nucleotide transport and metabolism [F] | 1.92 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.96 |
| COG0362 | 6-phosphogluconate dehydrogenase | Carbohydrate transport and metabolism [G] | 0.96 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
| COG1023 | 6-phosphogluconate dehydrogenase (decarboxylating) | Carbohydrate transport and metabolism [G] | 0.96 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 0.96 |
| COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 0.96 |
| COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 0.96 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.96 |
| COG3157 | Type VI protein secretion system component Hcp (secreted cytotoxin) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.96 |
| COG3194 | Ureidoglycolate hydrolase (allantoin degradation) | Nucleotide transport and metabolism [F] | 0.96 |
| COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.96 % |
| Unclassified | root | N/A | 49.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100508170 | Not Available | 1082 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101009137 | Not Available | 717 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101177125 | Not Available | 655 | Open in IMG/M |
| 3300004092|Ga0062389_102062793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300004092|Ga0062389_102246033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 718 | Open in IMG/M |
| 3300004092|Ga0062389_104084855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 548 | Open in IMG/M |
| 3300004152|Ga0062386_101282756 | Not Available | 609 | Open in IMG/M |
| 3300005541|Ga0070733_10261650 | Not Available | 1139 | Open in IMG/M |
| 3300005602|Ga0070762_10828186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
| 3300005995|Ga0066790_10330465 | Not Available | 650 | Open in IMG/M |
| 3300006041|Ga0075023_100421943 | Not Available | 582 | Open in IMG/M |
| 3300006052|Ga0075029_100152277 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300009500|Ga0116229_10113153 | All Organisms → cellular organisms → Bacteria | 2425 | Open in IMG/M |
| 3300009500|Ga0116229_10445315 | Not Available | 1077 | Open in IMG/M |
| 3300009500|Ga0116229_10615126 | Not Available | 892 | Open in IMG/M |
| 3300009510|Ga0116230_10599570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 835 | Open in IMG/M |
| 3300009522|Ga0116218_1507880 | Not Available | 537 | Open in IMG/M |
| 3300009624|Ga0116105_1196775 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300009635|Ga0116117_1080137 | Not Available | 810 | Open in IMG/M |
| 3300009641|Ga0116120_1106881 | Not Available | 921 | Open in IMG/M |
| 3300009701|Ga0116228_10874013 | Not Available | 601 | Open in IMG/M |
| 3300009701|Ga0116228_11141813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 516 | Open in IMG/M |
| 3300009709|Ga0116227_10476231 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300009709|Ga0116227_10885521 | Not Available | 672 | Open in IMG/M |
| 3300009787|Ga0116226_10334474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1555 | Open in IMG/M |
| 3300010343|Ga0074044_10587623 | Not Available | 727 | Open in IMG/M |
| 3300010880|Ga0126350_10276217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1384 | Open in IMG/M |
| 3300012189|Ga0137388_11002095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 771 | Open in IMG/M |
| 3300012927|Ga0137416_10547813 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300014167|Ga0181528_10685381 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300014169|Ga0181531_10392038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 854 | Open in IMG/M |
| 3300014200|Ga0181526_10436985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 830 | Open in IMG/M |
| 3300014201|Ga0181537_10028086 | All Organisms → cellular organisms → Bacteria | 3902 | Open in IMG/M |
| 3300014489|Ga0182018_10590717 | Not Available | 583 | Open in IMG/M |
| 3300014654|Ga0181525_10286262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 900 | Open in IMG/M |
| 3300014654|Ga0181525_10632009 | Not Available | 598 | Open in IMG/M |
| 3300014654|Ga0181525_10729567 | Not Available | 557 | Open in IMG/M |
| 3300017946|Ga0187879_10357690 | Not Available | 810 | Open in IMG/M |
| 3300018034|Ga0187863_10090383 | Not Available | 1719 | Open in IMG/M |
| 3300018034|Ga0187863_10406182 | Not Available | 759 | Open in IMG/M |
| 3300018038|Ga0187855_10344357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 870 | Open in IMG/M |
| 3300018062|Ga0187784_10917390 | Not Available | 697 | Open in IMG/M |
| 3300020580|Ga0210403_10607774 | Not Available | 882 | Open in IMG/M |
| 3300020581|Ga0210399_10711532 | Not Available | 825 | Open in IMG/M |
| 3300021402|Ga0210385_10165373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Solimonas | 1591 | Open in IMG/M |
| 3300021402|Ga0210385_10788290 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300021407|Ga0210383_11480818 | Not Available | 562 | Open in IMG/M |
| 3300021420|Ga0210394_10213740 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1683 | Open in IMG/M |
| 3300021477|Ga0210398_10765799 | Not Available | 779 | Open in IMG/M |
| 3300021856|Ga0213850_1113984 | Not Available | 561 | Open in IMG/M |
| 3300026557|Ga0179587_10451810 | Not Available | 841 | Open in IMG/M |
| 3300027635|Ga0209625_1125215 | Not Available | 576 | Open in IMG/M |
| 3300027676|Ga0209333_1112071 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300027860|Ga0209611_10295801 | Not Available | 953 | Open in IMG/M |
| 3300027860|Ga0209611_10409610 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300027884|Ga0209275_10868828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300027908|Ga0209006_10045828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3935 | Open in IMG/M |
| 3300027908|Ga0209006_10191722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1779 | Open in IMG/M |
| 3300027911|Ga0209698_11181268 | Not Available | 564 | Open in IMG/M |
| 3300028536|Ga0137415_10637888 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300028747|Ga0302219_10049688 | Not Available | 1564 | Open in IMG/M |
| 3300028762|Ga0302202_10494579 | Not Available | 553 | Open in IMG/M |
| 3300028776|Ga0302303_10200407 | Not Available | 691 | Open in IMG/M |
| 3300028808|Ga0302228_10316229 | Not Available | 698 | Open in IMG/M |
| 3300028808|Ga0302228_10376902 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300029911|Ga0311361_10606880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1040 | Open in IMG/M |
| 3300029911|Ga0311361_10898510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300029922|Ga0311363_11233546 | Not Available | 627 | Open in IMG/M |
| 3300029943|Ga0311340_10586286 | Not Available | 977 | Open in IMG/M |
| 3300029944|Ga0311352_10081216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2884 | Open in IMG/M |
| 3300029951|Ga0311371_12570152 | Not Available | 515 | Open in IMG/M |
| 3300029954|Ga0311331_10890164 | Not Available | 788 | Open in IMG/M |
| 3300029954|Ga0311331_11414528 | Not Available | 572 | Open in IMG/M |
| 3300029999|Ga0311339_10748668 | Not Available | 948 | Open in IMG/M |
| 3300030007|Ga0311338_10178527 | Not Available | 2480 | Open in IMG/M |
| 3300030013|Ga0302178_10338029 | Not Available | 684 | Open in IMG/M |
| 3300030053|Ga0302177_10264147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 927 | Open in IMG/M |
| 3300030058|Ga0302179_10196202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 891 | Open in IMG/M |
| 3300030399|Ga0311353_10666031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 902 | Open in IMG/M |
| 3300030490|Ga0302184_10352306 | Not Available | 581 | Open in IMG/M |
| 3300030503|Ga0311370_10210329 | All Organisms → cellular organisms → Bacteria | 2606 | Open in IMG/M |
| 3300030520|Ga0311372_10015813 | All Organisms → cellular organisms → Bacteria | 16237 | Open in IMG/M |
| 3300030520|Ga0311372_11826941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300030617|Ga0311356_10147904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2434 | Open in IMG/M |
| 3300030646|Ga0302316_10423740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae → Haliea → unclassified Haliea → Haliea sp. SAOS-164 | 534 | Open in IMG/M |
| 3300030739|Ga0302311_10005285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 13674 | Open in IMG/M |
| 3300030746|Ga0302312_10417596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 500 | Open in IMG/M |
| 3300030776|Ga0075396_1926236 | Not Available | 695 | Open in IMG/M |
| 3300030906|Ga0302314_11628924 | Not Available | 574 | Open in IMG/M |
| 3300031233|Ga0302307_10038763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2581 | Open in IMG/M |
| 3300031234|Ga0302325_10721245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1429 | Open in IMG/M |
| 3300031236|Ga0302324_103469077 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031525|Ga0302326_11618971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 859 | Open in IMG/M |
| 3300031708|Ga0310686_107114089 | Not Available | 521 | Open in IMG/M |
| 3300031708|Ga0310686_117394515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 4093 | Open in IMG/M |
| 3300031715|Ga0307476_10324652 | Not Available | 1131 | Open in IMG/M |
| 3300031788|Ga0302319_11114912 | Not Available | 738 | Open in IMG/M |
| 3300031823|Ga0307478_11306537 | Not Available | 603 | Open in IMG/M |
| 3300031823|Ga0307478_11550010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 548 | Open in IMG/M |
| 3300032896|Ga0335075_10175854 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2612 | Open in IMG/M |
| 3300033134|Ga0335073_10075251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4426 | Open in IMG/M |
| 3300033818|Ga0334804_074716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Candidatus Burkholderia verschuerenii | 920 | Open in IMG/M |
| 3300034130|Ga0370494_020396 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 25.96% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 10.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.69% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 6.73% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.73% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.77% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.85% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.85% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.88% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.96% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.96% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.96% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.96% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.96% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.96% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009510 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021856 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - LL:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300030776 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| 3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1005081701 | 3300002245 | Forest Soil | KYTIKFSIYNLTDRRNLTNDIPFYGNDFLTRQPPRSYDLTVSGKF* |
| JGIcombinedJ26739_1010091372 | 3300002245 | Forest Soil | LMVYNVANRVNWVNDNPFYGNDFLTRQPPRSFDLTVSGKF* |
| JGIcombinedJ26739_1011771252 | 3300002245 | Forest Soil | FSIYNVTDRHNLTNDIPFYGNDFLTRQPPTDFDLSLSAKF* |
| Ga0062389_1020627931 | 3300004092 | Bog Forest Soil | FQKLQAKFSIYNLTNRRNLTNDIPFYGNDFLTRQPPRDFDLSITAKF* |
| Ga0062389_1022460332 | 3300004092 | Bog Forest Soil | AGFYTFQNYTIKLSIYNLTDRVNFVNDIPFYGNDFIQRLPPRSFDLRLTGKF* |
| Ga0062389_1040848552 | 3300004092 | Bog Forest Soil | VKFSIYNLTDRHNLINDFPFYGNDFLTRVPPRAYDLTFSARF* |
| Ga0062386_1012827562 | 3300004152 | Bog Forest Soil | VYNLTDRHNLENDYPFYGNDFLTRVPPRSYDLTFNGSFEVAEVDAG* |
| Ga0070733_102616502 | 3300005541 | Surface Soil | KFTIYNLTDQHNLTNDIPFYGNDFLTRQPPRSYDLTLSGKF* |
| Ga0070762_108281862 | 3300005602 | Soil | KLSIYNLTDRVNFVNDIPFYGNDFIQRLPPRSFDLRLTGKF* |
| Ga0066790_103304652 | 3300005995 | Soil | YTVKFTIYNLTDQHNLTNDIPFYGNDFLTRQPPRSYDLTLSGKF* |
| Ga0075023_1004219432 | 3300006041 | Watersheds | FTIYNLTDQHNLTNDIPFYGNDFLTRQPPRSYDLSFSGKF* |
| Ga0075029_1001522771 | 3300006052 | Watersheds | YNLTDRHNLENDYPFYGNDFLTRVPPRSYDLSLTGKF* |
| Ga0116229_101131534 | 3300009500 | Host-Associated | EHYNVKFTVYNVTDRHNLLNDQGFYGNDFLTREPPRSFDLTFTGKF* |
| Ga0116229_104453151 | 3300009500 | Host-Associated | NVANRVNWVNDNPFYGNDFLTRQPSRSFDLTLTGKF* |
| Ga0116229_106151262 | 3300009500 | Host-Associated | SGYNITNQHNLTNDYSFYGNDFITRATPASVDLTLRARF* |
| Ga0116230_105995701 | 3300009510 | Host-Associated | KFEVYNLTNRRNLVNDQGFYGNDFLTVEPPRRYDLSLTGKF* |
| Ga0116218_15078801 | 3300009522 | Peatlands Soil | FYSFRQYTVKFAIYNLTDRHNLINDIPFYANDFLQRLPPRSFDLSLSGKF* |
| Ga0116105_11967752 | 3300009624 | Peatland | TIYNATNQHNLVNDIPFYGNDFLTRLPPRDYDLSVTAKF* |
| Ga0116117_10801371 | 3300009635 | Peatland | QFTLNTAVFYSIQNYTIKFTIYNATNQHNLVNDIPFYGNDFLTRLPPRDYDLSVTAKF* |
| Ga0116120_11068811 | 3300009641 | Peatland | QKYTVKFTIYNLTDRHNLINDIPFYANDFLTRVPPRSYDLSISGKF* |
| Ga0116228_108740132 | 3300009701 | Host-Associated | YKLNGAVFYSYQQYTVKFSVYNLTNRTNWTNDAPYYGDDFITRDPPRDFDLSVSARF* |
| Ga0116228_111418131 | 3300009701 | Host-Associated | TDQHNLINDYPFYGNDFITRAPPTSFDLTMKVKF* |
| Ga0116227_104762311 | 3300009709 | Host-Associated | LTDNRNLLNDQGFYGNDFLTRQPPRSYDLTFTGKF* |
| Ga0116227_108855212 | 3300009709 | Host-Associated | VYNLTDNRNLLNDQGFYGNDFLTRQPPRSYDLMVTGKF* |
| Ga0116226_103344741 | 3300009787 | Host-Associated | LMVYNLTSRHNLEPDYSYYGNDFLTRVPPRSYDLTFSGKF* |
| Ga0074044_105876232 | 3300010343 | Bog Forest Soil | VKFSIYNVTDQRNLINDIPFYGNDFITRVPPRSYDLSISGKF* |
| Ga0126350_102762171 | 3300010880 | Boreal Forest Soil | SIYNLANRRNLTNDIPFYGDDFLTRQPPRDYDLTISAKF* |
| Ga0137388_110020951 | 3300012189 | Vadose Zone Soil | LTDRHNLENDYPFYGNDFLTRVPPRSYDLTLSGKF* |
| Ga0137416_105478133 | 3300012927 | Vadose Zone Soil | SIYNLTDRHNLINDFPFYGNDFLTRVPPRAFDLTFSAKF* |
| Ga0181528_106853812 | 3300014167 | Bog | TDRHNLTNDIPFYGNDFLTRVPPRSYDLSLSGKF* |
| Ga0181531_103920383 | 3300014169 | Bog | KFSVYNLTDRRNLTNDIPFYGNDFLTRQPPRDYDLSVSARF* |
| Ga0181526_104369853 | 3300014200 | Bog | AIYNMTNRLNWTNDIPFYGDDFITRQPPRDFDLTISARF* |
| Ga0181537_100280866 | 3300014201 | Bog | TDRHNLQNDYPFYGNDFLTRLPPRSYDLTLSGKF* |
| Ga0182018_105907172 | 3300014489 | Palsa | IHWQYTLNSAVFYTFQKYTAKFSIYNMTNRRNWTNDIPFYGDDFITRQPPRDFDLTINARF* |
| Ga0181525_102862623 | 3300014654 | Bog | FQKYTVKFSVYNVTDRHNLTNDIPFYGNDFLTRQPPTDFDLSLSAKF* |
| Ga0181525_106320091 | 3300014654 | Bog | GALFYTFQKYTFKFTVYNLTDRHNFTNDVPFYGDDFITRQPPRDFDFNISARF* |
| Ga0181525_107295672 | 3300014654 | Bog | LNSAVFYSFQKYQLKFSVYNLTDRRNLTNDIPFYGNDFLTRQPPRDYDLSVSARF* |
| Ga0187879_103576901 | 3300017946 | Peatland | NLTDRHNLTNDTPFYGNDFLTRNPPRSYDLSISGKF |
| Ga0187863_100903832 | 3300018034 | Peatland | KYTVKFSVYNLTDRQNWTNDIPFYGNDFITRQPPRDFDLSINARF |
| Ga0187863_104061821 | 3300018034 | Peatland | QKYTAKLSVYNLTNRVNWTNDIPFYGDDFITRQPPRDFDLSITARF |
| Ga0187855_103443571 | 3300018038 | Peatland | WQYTLNSAIFYSFQKYQVKFSVYNLANKRNLTNDVPFYGNDFITRQPPRDFDLSVTARF |
| Ga0187784_109173901 | 3300018062 | Tropical Peatland | YTVKFTIYNLTDQHNLINDIPFYGNDFLTRVPPRSYNLSISGKF |
| Ga0210403_106077742 | 3300020580 | Soil | KYTIKFSIYNLTDRHNLTNDIPFYGNDFLTRQPPRSYDLTVSGKF |
| Ga0210399_107115322 | 3300020581 | Soil | IYNLTDRHNLTNDIPFYGNDFLTRQPPRSYDLTVSGKF |
| Ga0210385_101653733 | 3300021402 | Soil | YNLTSQHNLENDIPYYGNDFLTRIPPRSFDLSISGKF |
| Ga0210385_107882901 | 3300021402 | Soil | NLANRRNLTNDIPFYGDDFLTRQPPRDYDLTISAKF |
| Ga0210383_114808182 | 3300021407 | Soil | VKFEIYNLANERNLQNDYSFYGNDFLTLIPPRSYDLTFTAKL |
| Ga0210394_102137401 | 3300021420 | Soil | VNTAVFYSFLKYTVKFSVYNLTDQHNLTNDIPFYGNDFLTRQPPRDYDLSISAKF |
| Ga0210398_107657991 | 3300021477 | Soil | FQKYTIKFSIYNLTDRHNLTNDIPFYGNDFLTRQPPRSYDLTLSGKF |
| Ga0213850_11139841 | 3300021856 | Watersheds | IYNATGRHNWTNDYPFYGNDFITREPPRSFDLSVRYRFN |
| Ga0179587_104518102 | 3300026557 | Vadose Zone Soil | KFTIYNLTNRHNLTNDYPFYGNDFLTRNPPRSFDLTLSGKF |
| Ga0209625_11252152 | 3300027635 | Forest Soil | LNAAGFYSFQKYTVKFTIYNLTDQHNLTNDIPFYGNDFLTRQPPRSYDLTVSGKF |
| Ga0209333_11120712 | 3300027676 | Forest Soil | VFYAFQKFQAKFSIYNLTDRRNLTNDIPFYGNDFLTRVPPRSYDVSFSARF |
| Ga0209611_102958012 | 3300027860 | Host-Associated | EHYNVKFTVYNVTDRHNLLNDQGFYGNDFLTREPPRSFDLTFTGKF |
| Ga0209611_104096102 | 3300027860 | Host-Associated | LEHYTVKFEIYNLTDRHNLLNDQGFYGNDFLTREPPRSYDLTFTGKF |
| Ga0209275_108688281 | 3300027884 | Soil | KLSIYNLTDRVNFVNDIPFYGNDFIQRLPPRSFDLRLTGKF |
| Ga0209006_100458282 | 3300027908 | Forest Soil | VFYTYQKYTVKFSVYNVTDRHNLTNDIPFYGNDFLTRQPPTDFDLTLSARF |
| Ga0209006_101917223 | 3300027908 | Forest Soil | FYSFQKYTIKFSIYNLTDRRNLTNDIPFYGNDFLTRQPPRSYDLTVSGKF |
| Ga0209698_111812683 | 3300027911 | Watersheds | VKLSIYNLTDRHNLQNDYPFYGNDFLTRVPPRSFDLTVSGKF |
| Ga0137415_106378881 | 3300028536 | Vadose Zone Soil | NFLQHYTLKFSIYNLTDRHNLINDFPFYGNDFLTRVPPRAFDLTFSAKF |
| Ga0302219_100496882 | 3300028747 | Palsa | QRYQVKFSVYNLANKRNLTNDVPFYGNDFITRQPPRDFDLSVTARF |
| Ga0302202_104945791 | 3300028762 | Bog | FYTYDKYTVKLSVYNLTDRKNVVNDYPFYGNDFLTRLPPRSYDLSITGKF |
| Ga0302303_102004072 | 3300028776 | Palsa | QNYVIKFAIYNLTDQHNLVNDIPFYGNDFLQRLPPRSYDLTLSGKF |
| Ga0302228_103162291 | 3300028808 | Palsa | TFQKYTVKFSIYNVTDRHNLTNDIPFYGNDFLTRQPPTDFDLSLSARF |
| Ga0302228_103769021 | 3300028808 | Palsa | QQKYTVKFSVYNLTDQHNWTNDIPFYGNDFITRDPPRDYDLSISARF |
| Ga0311361_106068801 | 3300029911 | Bog | FTIYNATNQRNLLNDQGFYGNDFLTQVPPRSYDLTFTGKF |
| Ga0311361_108985102 | 3300029911 | Bog | YNLADRVNWLNDNPFYGNDFLTRQPPRSFDLTLTGKF |
| Ga0311363_112335461 | 3300029922 | Fen | TFAQHYTARFEIYNLTDNRNLLNDQGFYGNDFLTRQPPRSYDLTVSGKF |
| Ga0311340_105862861 | 3300029943 | Palsa | AVFYTYQQRYTVKFSVYNLTSEHNWTNDIPFYGNDFITRDPPRDYDLSISARF |
| Ga0311352_100812164 | 3300029944 | Palsa | KFSIYNVTDRHNLTNDIPFYGNDFLTRQPPTDFDLSLSARF |
| Ga0311371_125701521 | 3300029951 | Palsa | SIYNLTNERNLTNDVPFYGDDFITRQPPRDYDLSISAKF |
| Ga0311331_108901642 | 3300029954 | Bog | THYTVKFTIYNATNQRNLLNDQGFYGNDFLTQVPPRSYDLTFTGKF |
| Ga0311331_114145282 | 3300029954 | Bog | NLTNRRNVTNDIPFYGNDFLTQQPPRDFDLTISAKF |
| Ga0311339_107486683 | 3300029999 | Palsa | VYNLTSQHNLVNDYPYYGNDFLTRVPPRSYDLTLSGKF |
| Ga0311338_101785271 | 3300030007 | Palsa | VFYSYQKYTVKFSIYNLTGRQNFTNDVPFYGDDFITRQPPRDFDLSVSARF |
| Ga0302178_103380291 | 3300030013 | Palsa | VIHWQYTLNTAVFYSFQKYTVKFSIYNVTDRHNLTNDIPFYGNDFLTRQPPTDFDLSLSARF |
| Ga0302177_102641471 | 3300030053 | Palsa | VYNVTDRHNLTNDIPFYGNDFLTRQPPTDFDLTLSAKF |
| Ga0302179_101962021 | 3300030058 | Palsa | TVKFSIYNVTDRHNLTNDIPFYGNDFLTRQPPTDFDLSLSARF |
| Ga0311353_106660313 | 3300030399 | Palsa | AANRVNWLNDNPFYGNDFLTRQPPRSFDLTLTGKF |
| Ga0302184_103523062 | 3300030490 | Palsa | YTLNTAVFYTFQKYTVKFSIYNVTDRHNLTNDIPFYGNDFLTRQPPTDFDLSLSARF |
| Ga0311370_102103293 | 3300030503 | Palsa | TFQQKYTVKFSVYNLTDQHNWTNDIPFYGNDFITRDPPRDYDLSISARF |
| Ga0311372_100158131 | 3300030520 | Palsa | QYTLNSAVFYSYQKYTVKFSIYNLTGRQNFTNDVPFYGDDFITRQPPRDFDLSVSARF |
| Ga0311372_118269412 | 3300030520 | Palsa | VANRVNWVNDNPFYGNDFLTRQPPRSFDLTFTGKF |
| Ga0311357_110849482 | 3300030524 | Palsa | YTLNAAVFYGWQNYVIKFAIYNLTDQHNLVNDIPFYGNDFLQRLPPRSYDLTLSGKF |
| Ga0311356_101479044 | 3300030617 | Palsa | VFYSFQQYTVKFSVYNVTDRHNLTNDIPFYGNDFLTRQPPTDFDLTLSAKF |
| Ga0302316_104237402 | 3300030646 | Palsa | VVKFTVYNLTDQHNLINDVPFYGNDFITRVPPRSYDLNISGKF |
| Ga0302311_1000528515 | 3300030739 | Palsa | TAVFYTFQKYTVKFSIYNVTDRHNLTNDIPFYGNDFLTRQPPTDFDLSLSARF |
| Ga0302312_104175962 | 3300030746 | Palsa | TVKFSIYNLTSRQNLTNDYPFYGNDFLTRDPPRSFDLTLSGKF |
| Ga0075396_19262362 | 3300030776 | Soil | FYTYDERYTIKLMIYNLTDQHNKQNDYPFYGNDFLTFVPPRSYDLTLNAKF |
| Ga0302314_116289241 | 3300030906 | Palsa | FYSYQKYTVKFSIYNLTGRQNFTNDVPFYGDDFITRQPPRDFDLSVSARF |
| Ga0302307_100387635 | 3300031233 | Palsa | SFQNYKAKLSIYNLTNRRNVTNDIPFYGNDFLTQQPPRDFDLTLSAKF |
| Ga0302325_107212451 | 3300031234 | Palsa | FQKYTVKFSIYNVTDRHNLTNDIPFYGNDFLTRQPPTDFDLSLSARF |
| Ga0302324_1034690772 | 3300031236 | Palsa | WQYTLNAALFYSFEKYYTVKFSVYNLTSAHNWTNDIPFYGNDFITRDPPRDYDLSISARF |
| Ga0302326_116189712 | 3300031525 | Palsa | KFSVYNLTDRQNWTNDIPFYGNDFITRQPPRDYDLSISARF |
| Ga0310686_1071140892 | 3300031708 | Soil | YNLTNRRNVTNDIPFYGNDFLTQQPPRDFDLTISAKF |
| Ga0310686_1173945151 | 3300031708 | Soil | VANRRNLTNDVPFYGDDFITRQLPRDYDLSISAKF |
| Ga0307476_103246522 | 3300031715 | Hardwood Forest Soil | AAFYSFQKYTIKFSIYNLTDRHNLTNDIPFYGNDFLTRQPPRSYDLTVSGKF |
| Ga0302319_111149122 | 3300031788 | Bog | FEIYNLTDRHNLLNDQGFYGNDFLTREPPRSYDLTFTGKF |
| Ga0307478_113065372 | 3300031823 | Hardwood Forest Soil | TIYNLTDQHNLTNDIPFYGNDFLTRQPPRSYDLTLSGKF |
| Ga0307478_115500101 | 3300031823 | Hardwood Forest Soil | MVYNLTDQHNLINDYPFYGNDFLTRVPPRSYDLTLSGKF |
| Ga0335075_101758543 | 3300032896 | Soil | DLTDQRNLLNDIPFYGNDFLTREPPRSFDLTFSGKF |
| Ga0335073_100752515 | 3300033134 | Soil | VYNVTGQRNLTNDYPYYGNDFLTRVPPRSFDFMISGKL |
| Ga0334804_074716_2_169 | 3300033818 | Soil | LNSAIFYSFQKYQVKFSVYNLANKRNLTNDVPFYGNDFITRQPPRDFDLSVTARF |
| Ga0370494_020396_2_109 | 3300034130 | Untreated Peat Soil | LANRVNWVNDNPFYGNDFLTRQPTRSFDLTLSGKF |
| ⦗Top⦘ |