


| Basic Information | |
|---|---|
| Family ID | F096427 |
| Family Type | Metagenome |
| Number of Sequences | 104 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRTLAETMNERATKAIMLRIANDYDRLARRAEIRTGNRTTNE |
| Number of Associated Samples | 42 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 48.08 % |
| % of genes near scaffold ends (potentially truncated) | 53.85 % |
| % of genes from short scaffolds (< 2000 bps) | 88.46 % |
| Associated GOLD sequencing projects | 37 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.654 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.692 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.038 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (84.615 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.14% β-sheet: 0.00% Coil/Unstructured: 52.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 8.65 |
| PF00036 | EF-hand_1 | 5.77 |
| PF00248 | Aldo_ket_red | 1.92 |
| PF08042 | PqqA | 1.92 |
| PF00583 | Acetyltransf_1 | 1.92 |
| PF13545 | HTH_Crp_2 | 0.96 |
| PF00027 | cNMP_binding | 0.96 |
| PF04226 | Transgly_assoc | 0.96 |
| PF03631 | Virul_fac_BrkB | 0.96 |
| PF07045 | DUF1330 | 0.96 |
| PF13202 | EF-hand_5 | 0.96 |
| PF00701 | DHDPS | 0.96 |
| PF10686 | YAcAr | 0.96 |
| PF13924 | Lipocalin_5 | 0.96 |
| PF13185 | GAF_2 | 0.96 |
| PF07681 | DoxX | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 8.65 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.96 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.96 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.96 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.96 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.65 % |
| All Organisms | root | All Organisms | 41.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005332|Ga0066388_100679124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1640 | Open in IMG/M |
| 3300005332|Ga0066388_100856603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1493 | Open in IMG/M |
| 3300005332|Ga0066388_100939640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1437 | Open in IMG/M |
| 3300005332|Ga0066388_101510854 | Not Available | 1175 | Open in IMG/M |
| 3300005332|Ga0066388_101794086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1090 | Open in IMG/M |
| 3300005332|Ga0066388_103991866 | Not Available | 752 | Open in IMG/M |
| 3300005332|Ga0066388_104353824 | Not Available | 721 | Open in IMG/M |
| 3300005332|Ga0066388_105761320 | Not Available | 627 | Open in IMG/M |
| 3300005332|Ga0066388_106141388 | Not Available | 606 | Open in IMG/M |
| 3300005332|Ga0066388_108492648 | Not Available | 511 | Open in IMG/M |
| 3300005764|Ga0066903_100119668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3654 | Open in IMG/M |
| 3300005764|Ga0066903_100152009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3329 | Open in IMG/M |
| 3300005764|Ga0066903_100194467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3021 | Open in IMG/M |
| 3300005764|Ga0066903_101352622 | Not Available | 1334 | Open in IMG/M |
| 3300005764|Ga0066903_101802010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium | 1169 | Open in IMG/M |
| 3300005764|Ga0066903_101877088 | Not Available | 1147 | Open in IMG/M |
| 3300005764|Ga0066903_103540176 | Not Available | 841 | Open in IMG/M |
| 3300005764|Ga0066903_106071303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300005764|Ga0066903_107948556 | Not Available | 544 | Open in IMG/M |
| 3300005764|Ga0066903_109118153 | Not Available | 501 | Open in IMG/M |
| 3300006031|Ga0066651_10697922 | Not Available | 545 | Open in IMG/M |
| 3300009792|Ga0126374_10331013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1036 | Open in IMG/M |
| 3300009792|Ga0126374_11038373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
| 3300009792|Ga0126374_11587345 | Not Available | 540 | Open in IMG/M |
| 3300010048|Ga0126373_10853608 | Not Available | 974 | Open in IMG/M |
| 3300010048|Ga0126373_11687830 | Not Available | 698 | Open in IMG/M |
| 3300010048|Ga0126373_12174116 | Not Available | 616 | Open in IMG/M |
| 3300010048|Ga0126373_12366891 | Not Available | 591 | Open in IMG/M |
| 3300010358|Ga0126370_10962025 | Not Available | 776 | Open in IMG/M |
| 3300010361|Ga0126378_10302434 | Not Available | 1703 | Open in IMG/M |
| 3300010361|Ga0126378_12137377 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300010361|Ga0126378_13326249 | Not Available | 511 | Open in IMG/M |
| 3300010376|Ga0126381_100433083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1840 | Open in IMG/M |
| 3300010376|Ga0126381_100605986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1558 | Open in IMG/M |
| 3300010376|Ga0126381_100631959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1526 | Open in IMG/M |
| 3300010376|Ga0126381_101891141 | Not Available | 861 | Open in IMG/M |
| 3300010376|Ga0126381_102462304 | Not Available | 746 | Open in IMG/M |
| 3300010376|Ga0126381_103567096 | Not Available | 610 | Open in IMG/M |
| 3300010376|Ga0126381_103728486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 596 | Open in IMG/M |
| 3300010398|Ga0126383_11350211 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300010868|Ga0124844_1113697 | Not Available | 1032 | Open in IMG/M |
| 3300010868|Ga0124844_1116040 | Not Available | 1021 | Open in IMG/M |
| 3300012971|Ga0126369_10319946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1561 | Open in IMG/M |
| 3300012971|Ga0126369_11442783 | Not Available | 778 | Open in IMG/M |
| 3300012971|Ga0126369_12318124 | Not Available | 623 | Open in IMG/M |
| 3300012971|Ga0126369_12407168 | Not Available | 612 | Open in IMG/M |
| 3300012971|Ga0126369_13130411 | Not Available | 542 | Open in IMG/M |
| 3300016294|Ga0182041_10274472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1385 | Open in IMG/M |
| 3300016319|Ga0182033_10949413 | Not Available | 763 | Open in IMG/M |
| 3300016319|Ga0182033_11062520 | Not Available | 722 | Open in IMG/M |
| 3300016319|Ga0182033_11116927 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300016319|Ga0182033_11358377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 639 | Open in IMG/M |
| 3300016357|Ga0182032_11203673 | Not Available | 652 | Open in IMG/M |
| 3300016404|Ga0182037_10736321 | Not Available | 846 | Open in IMG/M |
| 3300016445|Ga0182038_10739995 | Not Available | 859 | Open in IMG/M |
| 3300016445|Ga0182038_10868471 | Not Available | 794 | Open in IMG/M |
| 3300016445|Ga0182038_12111381 | Not Available | 511 | Open in IMG/M |
| 3300017994|Ga0187822_10169513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 712 | Open in IMG/M |
| 3300018433|Ga0066667_10680619 | Not Available | 862 | Open in IMG/M |
| 3300018433|Ga0066667_12297563 | Not Available | 505 | Open in IMG/M |
| 3300021560|Ga0126371_10185115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2169 | Open in IMG/M |
| 3300021560|Ga0126371_10267976 | Not Available | 1827 | Open in IMG/M |
| 3300021560|Ga0126371_10418305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1484 | Open in IMG/M |
| 3300021560|Ga0126371_12802076 | Not Available | 591 | Open in IMG/M |
| 3300027874|Ga0209465_10382214 | Not Available | 705 | Open in IMG/M |
| 3300031545|Ga0318541_10313712 | Not Available | 875 | Open in IMG/M |
| 3300031545|Ga0318541_10815993 | Not Available | 520 | Open in IMG/M |
| 3300031573|Ga0310915_10183744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1457 | Open in IMG/M |
| 3300031680|Ga0318574_10503117 | Not Available | 710 | Open in IMG/M |
| 3300031719|Ga0306917_10412652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium macuxiense | 1055 | Open in IMG/M |
| 3300031719|Ga0306917_10670166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 815 | Open in IMG/M |
| 3300031744|Ga0306918_10199534 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1507 | Open in IMG/M |
| 3300031744|Ga0306918_10223482 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300031744|Ga0306918_10254146 | Not Available | 1342 | Open in IMG/M |
| 3300031744|Ga0306918_10845100 | Not Available | 714 | Open in IMG/M |
| 3300031770|Ga0318521_10962761 | Not Available | 523 | Open in IMG/M |
| 3300031845|Ga0318511_10554857 | Not Available | 534 | Open in IMG/M |
| 3300031879|Ga0306919_10101796 | Not Available | 2022 | Open in IMG/M |
| 3300031890|Ga0306925_10058359 | Not Available | 4038 | Open in IMG/M |
| 3300031910|Ga0306923_12307914 | Not Available | 536 | Open in IMG/M |
| 3300031912|Ga0306921_10218069 | Not Available | 2236 | Open in IMG/M |
| 3300031912|Ga0306921_10289137 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1919 | Open in IMG/M |
| 3300031946|Ga0310910_10218814 | Not Available | 1481 | Open in IMG/M |
| 3300031947|Ga0310909_10019339 | All Organisms → cellular organisms → Bacteria | 4878 | Open in IMG/M |
| 3300032001|Ga0306922_10115411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2852 | Open in IMG/M |
| 3300032001|Ga0306922_10148479 | Not Available | 2505 | Open in IMG/M |
| 3300032001|Ga0306922_10501140 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1294 | Open in IMG/M |
| 3300032042|Ga0318545_10228290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 668 | Open in IMG/M |
| 3300032044|Ga0318558_10642744 | Not Available | 530 | Open in IMG/M |
| 3300032059|Ga0318533_10211889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1391 | Open in IMG/M |
| 3300032064|Ga0318510_10394245 | Not Available | 589 | Open in IMG/M |
| 3300032076|Ga0306924_10228004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2139 | Open in IMG/M |
| 3300032076|Ga0306924_11402693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 745 | Open in IMG/M |
| 3300032076|Ga0306924_12437830 | Not Available | 526 | Open in IMG/M |
| 3300032076|Ga0306924_12463495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300032261|Ga0306920_100140116 | All Organisms → cellular organisms → Bacteria | 3600 | Open in IMG/M |
| 3300032261|Ga0306920_101063648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1175 | Open in IMG/M |
| 3300032261|Ga0306920_101068524 | Not Available | 1172 | Open in IMG/M |
| 3300032261|Ga0306920_101715772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium olei | 889 | Open in IMG/M |
| 3300032261|Ga0306920_104214801 | Not Available | 518 | Open in IMG/M |
| 3300032261|Ga0306920_104424204 | Not Available | 503 | Open in IMG/M |
| 3300033289|Ga0310914_10965070 | Not Available | 752 | Open in IMG/M |
| 3300033290|Ga0318519_10309821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 926 | Open in IMG/M |
| 3300033290|Ga0318519_10698099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 620 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 26.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 22.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066388_1006791241 | 3300005332 | Tropical Forest Soil | MRAFAGTTKERATKAIMLRIANDYDRLARHADARTGNRTNK* |
| Ga0066388_1008566032 | 3300005332 | Tropical Forest Soil | MRTISETMKERATKAIMLRIADDYDKLAKRAEFRTGKRNNN* |
| Ga0066388_1009396402 | 3300005332 | Tropical Forest Soil | RQRAAEMRTLAETMNERATKAIMLRIANDYDRLARRAEIRAGNTTNNN* |
| Ga0066388_1015108542 | 3300005332 | Tropical Forest Soil | MRAVAGTIKERATKAIMLRIANDYDRLARRADARTGNRTSE* |
| Ga0066388_1017940861 | 3300005332 | Tropical Forest Soil | HWRQRAQEMRALAGTMKARATKAIMLRIANDYDRLARHAEARTGSGTISK* |
| Ga0066388_1039918662 | 3300005332 | Tropical Forest Soil | MRALAEVMKHRATKAIMRRIADDYDKLAHRAEVRTGNKAINK* |
| Ga0066388_1043538241 | 3300005332 | Tropical Forest Soil | MRTLAEIMKEPATKAIMLRIADDYDKLAKRAEIRTGKRTN* |
| Ga0066388_1057613201 | 3300005332 | Tropical Forest Soil | MRTLAETMKEQATKAIMLRIADDYDRLARRAEIRTGNTA* |
| Ga0066388_1061413881 | 3300005332 | Tropical Forest Soil | MRTLAETMKEQATKAIMLRIADDYDKLAKHAEIRTGNRTPTSK* |
| Ga0066388_1084926482 | 3300005332 | Tropical Forest Soil | MRTIAETMSEQATKLIMLRIADDYDKLARRAEIRTGNRTTTNK* |
| Ga0066903_1001196684 | 3300005764 | Tropical Forest Soil | GEEMRTLADTMKDARTKAIMLRIADDYDKLADRAEVRTGKRTTHN* |
| Ga0066903_1001520092 | 3300005764 | Tropical Forest Soil | MRTLADTMKDARTKAIMLRIADDYDKLADRAEVRTGKRRTHN* |
| Ga0066903_1001944677 | 3300005764 | Tropical Forest Soil | MRTLAGTMKEQATKAIMLRIADDYDRLARRAEIRTGNTA* |
| Ga0066903_1013526222 | 3300005764 | Tropical Forest Soil | MRTFAGTMKEPATKAIMLRIGDDCDKLAKRAEIRTGNRTTTNK* |
| Ga0066903_1018020102 | 3300005764 | Tropical Forest Soil | MRTIAETMNEQATKAIMLRIADDYDKLAKRAEIRTGNRTT |
| Ga0066903_1018770884 | 3300005764 | Tropical Forest Soil | MRTLADGMKDGATKAIMLRIADDYDKLAKRAEVRTGNKAINK* |
| Ga0066903_1035401761 | 3300005764 | Tropical Forest Soil | MRTLAGTMKEPATKAIMLRIADEYEKLAKRAEIRTGTRTTIR* |
| Ga0066903_1060713031 | 3300005764 | Tropical Forest Soil | MRTLAETMKERATKAIMLRIANDYDRLARRAEIRTGNTTNNK* |
| Ga0066903_1079485562 | 3300005764 | Tropical Forest Soil | MRTLAETMKERATKAIMLRIANDYDRLARRAEIRKPAGDSTDNN* |
| Ga0066903_1091181532 | 3300005764 | Tropical Forest Soil | RTLAETMNERATKAIMLRIANDYDRLARRAEIRTNDK* |
| Ga0066651_106979222 | 3300006031 | Soil | LAETMKEPATKAIMLRIADDYDKLAERAEIRTGARTNNK* |
| Ga0126374_103310131 | 3300009792 | Tropical Forest Soil | QRAAEMRTLAETMNERATKAIMLRIANDYDRLARRAEIRAGNTTNNN* |
| Ga0126374_110383732 | 3300009792 | Tropical Forest Soil | MRTIAETMKERATKAIMLRIADDYDKLAKRAEFRTGKRNNN* |
| Ga0126374_115873452 | 3300009792 | Tropical Forest Soil | MRALAGTIKERATKAIVLRIANDYDRLARHADAEIGNRTNK* |
| Ga0126373_108536083 | 3300010048 | Tropical Forest Soil | EEMRALAGTIKERATKAIMLRIANDYDRLARHADARTDNRTST* |
| Ga0126373_116878301 | 3300010048 | Tropical Forest Soil | MRTLAETMKDQATKAIMFRIADDYDKLAKRAEIRTGNK* |
| Ga0126373_121741161 | 3300010048 | Tropical Forest Soil | MRALAGTIKERATKAIMLRIANDYDRLARHADAEIGNRTNK* |
| Ga0126373_123668912 | 3300010048 | Tropical Forest Soil | MRAVAGTIKERATKAIMLRIANDYDRLARRADARTGNRTNK* |
| Ga0126370_109620251 | 3300010358 | Tropical Forest Soil | PNHWRQRAAEMRTLAETMNERATKPIMLRIANDYDRLARRAEIRTNNK* |
| Ga0126378_103024341 | 3300010361 | Tropical Forest Soil | WRQRAAEMRTLAETMNERATKAIMLRIANDYDRLARRAEIRTNNK* |
| Ga0126378_121373771 | 3300010361 | Tropical Forest Soil | AAEMRTLAETMNERATKAIMLRIANDYDRLARRAELRTHNK* |
| Ga0126378_133262491 | 3300010361 | Tropical Forest Soil | KERATKAIMLRIANDYDRLARHAEARSSSGINSK* |
| Ga0126381_1004330833 | 3300010376 | Tropical Forest Soil | MRALAGTIKERATKAIMLRIANDYDRLARHADARTGNITNK* |
| Ga0126381_1006059863 | 3300010376 | Tropical Forest Soil | WRQRAAEMRTLAETMNERATKAIMLRIANDYDRLARRAEIRAGNTTNNN* |
| Ga0126381_1006319593 | 3300010376 | Tropical Forest Soil | MRALAGTIKERATKAIMLRIANDYDRLARHADAEIGNRT |
| Ga0126381_1018911411 | 3300010376 | Tropical Forest Soil | MRAVAGTIKERATKAIMLRIANDYDRLARHADARTGNRTNK* |
| Ga0126381_1024623041 | 3300010376 | Tropical Forest Soil | TRQIMLRIADDYDKLAERAEIRTGNRTTYEQIVSLK* |
| Ga0126381_1035670962 | 3300010376 | Tropical Forest Soil | MRTLAETMKERATKAIMLRIANDYDRLGRRAENRTNND* |
| Ga0126381_1037284861 | 3300010376 | Tropical Forest Soil | NHWRQRAAEMRTLAETMNERATKAIMLRIANDYDRLARRAEPRTHNK* |
| Ga0126383_113502112 | 3300010398 | Tropical Forest Soil | MRALAGTIKERATKAIMLRIANDYDRLARHADARTGNRTNK* |
| Ga0124844_11136971 | 3300010868 | Tropical Forest Soil | MRTIVETMNGRPTREIMLRIADDYDNYDKLAERAEIRTGKRTTTNK* |
| Ga0124844_11160401 | 3300010868 | Tropical Forest Soil | LAAAKRGNALRTIVETMNERATRVIMLRIADDYDKLAERAEIRTGKRTTTNK* |
| Ga0126369_103199461 | 3300012971 | Tropical Forest Soil | TMNERATKAIMLRIANDYDRLARRAEIRAGNTTNNN* |
| Ga0126369_114427831 | 3300012971 | Tropical Forest Soil | RTLAGIMKERVTRQIMLRIADDYDKLAERAEIRTGNRTTTNK* |
| Ga0126369_123181241 | 3300012971 | Tropical Forest Soil | MRTLADTMKDARTKAIMLRIADDYDKLADRAEVRTGKRTTHN* |
| Ga0126369_124071683 | 3300012971 | Tropical Forest Soil | TLAGIMKERVTRQIMLRIADDYDKLAERAEIRTGNRTTTNK* |
| Ga0126369_131304111 | 3300012971 | Tropical Forest Soil | LAETMNERATKAIMLRIANDYDRLARRAEIRTGNRTTNE* |
| Ga0182041_102744722 | 3300016294 | Soil | MRTLAGTIKERATKAIMLRIANDYDRLARHAEARTGSGTNSE |
| Ga0182033_109494131 | 3300016319 | Soil | MRTLAETMNERATKAIMLRIANDYDRLARRAEIRTNNK |
| Ga0182033_110625202 | 3300016319 | Soil | RTLAETMNERATKAIMLRIANDYDRLAGRAEIRTNNK |
| Ga0182033_111169271 | 3300016319 | Soil | MRAVAGTIKERATKAIMLRIANDYDRLARHAEARSGNINN |
| Ga0182033_113583771 | 3300016319 | Soil | QRAAEIRTLAETMNERATKAIMLRIANDYDRLARRAEIRTNNK |
| Ga0182032_112036731 | 3300016357 | Soil | RGEEMRALAGTIKERATKAITLRIANDYDRLTRHADARTDNRAST |
| Ga0182037_107363211 | 3300016404 | Soil | TIKERATKAIMLRIANDYDRLARHADALTGKRTNK |
| Ga0182038_107399951 | 3300016445 | Soil | ETMNERATKAIMLRVANDYDRLARRAEIRTGNRTTNE |
| Ga0182038_108684711 | 3300016445 | Soil | RAAEMRTLAEMMNERATKAIMQRIANDYDRLARCAEIRTNNK |
| Ga0182038_121113811 | 3300016445 | Soil | LAGTMNEQATKAIMLRIADDYDKLARRAEIRTGDGTTTDK |
| Ga0187822_101695132 | 3300017994 | Freshwater Sediment | MRTLADGVKDRETKAIMLRIADDYDNLAEQAEVRTGNKAKNK |
| Ga0066667_106806191 | 3300018433 | Grasslands Soil | EEMRTLAETMKEPATKAIMLRIADDYDKLAERAEIRTGARTNNK |
| Ga0066667_122975631 | 3300018433 | Grasslands Soil | MRTLAETMKEPATKAIMLRIADDYDKLAKRAAIRTGKTNNY |
| Ga0126371_101851152 | 3300021560 | Tropical Forest Soil | MRTIAETMKERATKAIMLRIADDYDKLAKRAEFRTGKRNNN |
| Ga0126371_102679765 | 3300021560 | Tropical Forest Soil | LAGTMKEQATKAIMLRIADDYDRLARRAEIRTGNTA |
| Ga0126371_104183053 | 3300021560 | Tropical Forest Soil | LAERATKAIMLRIANDFDRLARRAEIRAGNTTNNN |
| Ga0126371_128020762 | 3300021560 | Tropical Forest Soil | RTLADTMKDARTKAIMLRIADDYDKLAERAEVRTGKGTAKE |
| Ga0209465_103822141 | 3300027874 | Tropical Forest Soil | WRQRGEEMRALAGTIKERATKAIMLRIANDYDRLARHADAEIGNRTNK |
| Ga0318541_103137122 | 3300031545 | Soil | MRALAGTIKERATKAIMLRIANDYDRLARHAEARTGSGTNSE |
| Ga0318541_108159932 | 3300031545 | Soil | MRALAGTIKERATKAIMLRIANDYDRLARHADARTGNRTNK |
| Ga0310915_101837441 | 3300031573 | Soil | EMRALAGTIKERATKAIMLRIANDYDRLARHAEARTGSGTNSE |
| Ga0318574_105031171 | 3300031680 | Soil | MRALAGTIKERATKAIMLRIANDYDRLARHADARTGNRT |
| Ga0306917_104126522 | 3300031719 | Soil | MRAVAGTIKERATKAIMLRIANDYDRLARHADARTGKKQTNK |
| Ga0306917_106701663 | 3300031719 | Soil | NHWRQRAAEMRTLAETMNERATKAIMLRIANDYDRLAKRAEIRANNK |
| Ga0306918_101995343 | 3300031744 | Soil | AEIRTLAETMNERATKAIMLRIANDYDRLARRAEIRTNDK |
| Ga0306918_102234823 | 3300031744 | Soil | MRALAGTIKERATKAIMLRIANDYDRLARHADART |
| Ga0306918_102541463 | 3300031744 | Soil | MRVLAGTIKERATKAIMLRIANDYDRLARHAGARTGNRTNK |
| Ga0306918_108451001 | 3300031744 | Soil | GEEMRALAGTIKERATKAIMLRIANDYDRLARHADARTGNITNK |
| Ga0318521_109627611 | 3300031770 | Soil | VRTLAETMKERATKAIMLRIADCYDKFAKRAEIRGNRTTTTNK |
| Ga0318511_105548571 | 3300031845 | Soil | MRALAGTIKERATKAIMLRIANDYDRLARHADARTDNRT |
| Ga0306919_101017961 | 3300031879 | Soil | RTLAETMNERATKAIMLRIANDYDRLARRAEIRTNNK |
| Ga0306925_1005835910 | 3300031890 | Soil | MRVLAGTIKERATKAIMLRIANDYDRLARHADARTGNRTNK |
| Ga0306923_123079142 | 3300031910 | Soil | WRQRAAEMRTLAETMNERATKAIMLRIANDYDRLARRAEIRTNNK |
| Ga0306921_102180693 | 3300031912 | Soil | MRTLAETMKEQATKAIMLRIADDYDKLAKHAEIRTGNRTTTHK |
| Ga0306921_102891371 | 3300031912 | Soil | TLAETMNERATKAIMLRIANDYDRLARRAEIRTNDK |
| Ga0310910_102188141 | 3300031946 | Soil | MRTLAETMNERATKAIMLRIANDYDRLARRAEIRTGNRTTNE |
| Ga0310909_100193397 | 3300031947 | Soil | MRALAGTIKERATKAIMLRIANDYDRLARHVDARTGNKTNK |
| Ga0306922_101154111 | 3300032001 | Soil | MRALAGTIKERATKVIMLRIANDYDRLARHGEARTGSGTNSE |
| Ga0306922_101484794 | 3300032001 | Soil | MRTLAETMKEQATKAIMLGIADDYDKLAKHAEIRTGNRTTTHK |
| Ga0306922_105011401 | 3300032001 | Soil | LAETMNERATKAIMLRIANDYDRLARRAEIRTNDK |
| Ga0318545_102282901 | 3300032042 | Soil | RALAGTIKERATKAIMLRIANDYDRLARHADARTGNITNK |
| Ga0318558_106427441 | 3300032044 | Soil | MRTLAETMNERATKAIMLRIANDYDRLAKRAEIRANNK |
| Ga0318533_102118892 | 3300032059 | Soil | MTQSWRQRGEEMRALAGTIKERATKAIMLRIANDYDRLARHAEARTGSGTNSE |
| Ga0318510_103942451 | 3300032064 | Soil | QRGEEMRTLAETMKEQATKAIMLRIADDYDKLAKHAEIRTGNRTTTHK |
| Ga0306924_102280042 | 3300032076 | Soil | QSWRQRGEEMRALAGTIKERATKAIMLRIANDYDRLARHAEARTGSGTNSE |
| Ga0306924_114026931 | 3300032076 | Soil | MRTLAETMKERETKAIMLRIAHDYDRLPRRAEIRTGNTTSNNK |
| Ga0306924_124378301 | 3300032076 | Soil | MRAVAGTIKERATKAIMLRIANDYDRLARHADARTGNKTNK |
| Ga0306924_124634951 | 3300032076 | Soil | MRTLAETMKERATKSIMLRIAHDYDRLTKRAEILTGNTTNNK |
| Ga0306920_1001401166 | 3300032261 | Soil | MRALAGTIKERATKAIMLRIANDYDRLARHADARTGNITNK |
| Ga0306920_1010636481 | 3300032261 | Soil | MRTLAEIMKEQATRAIMLRIADDYDELARRAEIRTGDTSN |
| Ga0306920_1010685243 | 3300032261 | Soil | AVAGTIKERATKAIMLRIANDYDRLARHADARTGNKTNK |
| Ga0306920_1017157721 | 3300032261 | Soil | TLAETMNERATKAIMLRIANDYDRLARRAEIRTNNK |
| Ga0306920_1042148012 | 3300032261 | Soil | MRAVAGTIKERATKAIMLRIANDYDRLARHADARTGKKQTN |
| Ga0306920_1044242041 | 3300032261 | Soil | EEMRALAGTIKERATKAIMLRIANDYDRLARHADARTGNRTNQ |
| Ga0310914_109650703 | 3300033289 | Soil | MRTLAGTMNEQATKAIMLRIADDYDKLARRAEIRTGDGTTTDK |
| Ga0318519_103098213 | 3300033290 | Soil | WRQRGEEMRALAGTIKERATKAIMLRIANDYDRLARHAEARTGSGTNSE |
| Ga0318519_106980991 | 3300033290 | Soil | LAETMNERATKAIMLRIANDYDRLARRAEIRTNNK |
| ⦗Top⦘ |