


| Basic Information | |
|---|---|
| Family ID | F096271 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MERFIAGLVKDFESGKVDRREFCKTVALAATVYAAGDAAQAQ |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 81.82 % |
| % of genes near scaffold ends (potentially truncated) | 10.48 % |
| % of genes from short scaffolds (< 2000 bps) | 8.57 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (90.476 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (14.286 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.714 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.43% β-sheet: 0.00% Coil/Unstructured: 48.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF15956 | DUF4760 | 7.62 |
| PF04909 | Amidohydro_2 | 2.86 |
| PF13188 | PAS_8 | 2.86 |
| PF03401 | TctC | 1.90 |
| PF13305 | TetR_C_33 | 1.90 |
| PF14312 | FG-GAP_2 | 1.90 |
| PF01904 | DUF72 | 1.90 |
| PF13601 | HTH_34 | 1.90 |
| PF01925 | TauE | 0.95 |
| PF04199 | Cyclase | 0.95 |
| PF01436 | NHL | 0.95 |
| PF13432 | TPR_16 | 0.95 |
| PF06277 | EutA | 0.95 |
| PF13472 | Lipase_GDSL_2 | 0.95 |
| PF02424 | ApbE | 0.95 |
| PF01522 | Polysacc_deac_1 | 0.95 |
| PF02633 | Creatininase | 0.95 |
| PF13620 | CarboxypepD_reg | 0.95 |
| PF05050 | Methyltransf_21 | 0.95 |
| PF02826 | 2-Hacid_dh_C | 0.95 |
| PF08450 | SGL | 0.95 |
| PF00589 | Phage_integrase | 0.95 |
| PF08448 | PAS_4 | 0.95 |
| PF05985 | EutC | 0.95 |
| PF14326 | DUF4384 | 0.95 |
| PF10282 | Lactonase | 0.95 |
| PF02146 | SIR2 | 0.95 |
| PF00441 | Acyl-CoA_dh_1 | 0.95 |
| PF01977 | UbiD | 0.95 |
| PF00857 | Isochorismatase | 0.95 |
| PF00724 | Oxidored_FMN | 0.95 |
| PF00710 | Asparaginase | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0252 | L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D | Translation, ribosomal structure and biogenesis [J] | 1.90 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 1.90 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.90 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.95 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.95 |
| COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.95 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.95 |
| COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.95 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.95 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.95 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.95 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.95 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.95 |
| COG4302 | Ethanolamine ammonia-lyase, small subunit | Amino acid transport and metabolism [E] | 0.95 |
| COG4819 | Ethanolamine utilization protein EutA, possible chaperonin | Amino acid transport and metabolism [E] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 90.48 % |
| All Organisms | root | All Organisms | 9.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005332|Ga0066388_101445677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1198 | Open in IMG/M |
| 3300005554|Ga0066661_10506363 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300006354|Ga0075021_10455538 | Not Available | 807 | Open in IMG/M |
| 3300006847|Ga0075431_100926183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 840 | Open in IMG/M |
| 3300010047|Ga0126382_11464079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300010362|Ga0126377_10141167 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
| 3300012189|Ga0137388_10970507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 785 | Open in IMG/M |
| 3300012207|Ga0137381_10084545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2670 | Open in IMG/M |
| 3300027874|Ga0209465_10516770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300027903|Ga0209488_10283672 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 1238 | Open in IMG/M |
| 3300031770|Ga0318521_10262727 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1010 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.90% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.90% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.90% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.95% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.95% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.95% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.95% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.95% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.95% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031800 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051 | Environmental | Open in IMG/M |
| 3300031804 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_AW_Bot5 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1002174131 | 3300000955 | Soil | MERFIADLVKDFEGGKIDRRQFCETVALAATVYAAGSAAQAAPAQGLKM |
| YBBDRAFT_10615572 | 3300001372 | Marine Estuarine | MERFIADLVKDFESGKINRRQFCETVALATTVFAA |
| JGI12053J15887_102927921 | 3300001661 | Forest Soil | MERFIADLVKQFEGGTVDRREFCQTVALAAAVYAAGDTANAQTGTGFKV |
| JGI12053J15887_104170721 | 3300001661 | Forest Soil | MERFIANLVKDFESGKLDRRQFCETVALAATVYAAGEGAANAAP |
| JGIcombinedJ26739_1013189972 | 3300002245 | Forest Soil | MERFIAGLVKDFESGKVDRREFCQTVALAAVVYGTGEAANAQ |
| soilH1_103803631 | 3300003321 | Sugarcane Root And Bulk Soil | MERFIADLVKRFEDGKITRRQFCETVAVAATVYAAGESAANAAPTQGFK |
| Ga0062389_1045595941 | 3300004092 | Bog Forest Soil | MERFIAGLVTDFESGKVDRREFCQTVALAAVVYAAGDAAN |
| Ga0066676_101686413 | 3300005186 | Soil | MERFIADLVKNFESGKINRRQFCETVALAATVYAAGEEAANAAPSQGFK |
| Ga0066388_1014456772 | 3300005332 | Tropical Forest Soil | MERFIADLVQGLDSGRIDRREFCKSVALAAAVYGAGDAAQAQVQRGFKI |
| Ga0066388_1070458381 | 3300005332 | Tropical Forest Soil | MERFIAGLVQGLDSGKIDRREFCKSVALAAAVYGAGDAAQAQVQRGFK |
| Ga0070703_102764891 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MERFIADLVKDFESGKVSRRQFCETVALAATVYAAGDAAQAAPAQG |
| Ga0066661_105063631 | 3300005554 | Soil | MERFIAGLVQGLDSGKIDRREFCQSVALAAAVYGAGDAAQAQVQRGFKII |
| Ga0070762_101446811 | 3300005602 | Soil | MEGFVADLVKSFESGKIDSREFCQTIALAATVYAAGDAAHAQTSTG |
| Ga0081540_11705192 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MERFIADLVRNFESGRINRRQFCEAVTLAASVYAMGDAAKAQPARGLK |
| Ga0075021_104555382 | 3300006354 | Watersheds | MERFIADLVRSFESGKIDRRQFCEAVALATTVFAAGSAAEAAPARGLK |
| Ga0075021_110857133 | 3300006354 | Watersheds | MERFIADLVQGLDSGQIDRREFCKTVALAAAVYGAGDAAQ |
| Ga0066658_104956051 | 3300006794 | Soil | MERFIADLVKRFEGGKIDRREFCQTVALAATVCAAG |
| Ga0075431_1009261832 | 3300006847 | Populus Rhizosphere | MERFIADLVKQFEGGAIDRREFCQTVALAAAVYAAGDAANAQTGTGFKV |
| Ga0075425_1009520532 | 3300006854 | Populus Rhizosphere | MERFIADLVKQFEGGAIDRREFCQTVALAAAVYAAG |
| Ga0066710_1041766001 | 3300009012 | Grasslands Soil | MERFIADLVQDFESGKINRRQFCETVALAATVYAAGEEAANAAPSQGFK |
| Ga0111539_114833631 | 3300009094 | Populus Rhizosphere | MERFIADLVKDFESGKVSRRQFCETVALAATVYAAGDAAQAAPAQ |
| Ga0099792_100018257 | 3300009143 | Vadose Zone Soil | MERFIADLVKQFEGGTVDRREFCQTVALAAAVYAAGDTA |
| Ga0099792_105352781 | 3300009143 | Vadose Zone Soil | MERFIADLVKDYESGKVDRREFCKTVALAATVYAAGDAAMAQ |
| Ga0116216_105292361 | 3300009698 | Peatlands Soil | MERFIADLVQGLDAGRLDRREFCQAVALAAAVYGAGDAAQAQAK |
| Ga0126384_103337731 | 3300010046 | Tropical Forest Soil | MERFIADLVQDFESGKINRRQFCETVALAATVYAAG |
| Ga0126384_115504582 | 3300010046 | Tropical Forest Soil | MERFIADLVQGLDSGRIDRREFCKSVALAAVVYSAGDAAQAQVPRGF |
| Ga0126382_114640792 | 3300010047 | Tropical Forest Soil | MGAPIREDYGMERFIADLVSSFESGKIDRRQFCETVALAATVYAAGTAATEAAPARGL |
| Ga0123356_110464351 | 3300010049 | Termite Gut | MERFIAGLVQDLDSGNIDRREFCKSVALAAAVYGAGDAA |
| Ga0126370_102639111 | 3300010358 | Tropical Forest Soil | MERFIANLAEGLDTGAIDRREFCKAAALAAAVYGAGEA |
| Ga0126376_114772261 | 3300010359 | Tropical Forest Soil | MERFIADLVQGLDSGKIDRREFCQAVALAAAVYGAGDAAQ |
| Ga0126372_104221123 | 3300010360 | Tropical Forest Soil | MERFIANLVEGLDTGAIDRREFCKAVALAAAVYGAGDAAR |
| Ga0126372_129776823 | 3300010360 | Tropical Forest Soil | MERFIANLVKQYESGAVDRREFCKTLALAATVYAAGDTAKA |
| Ga0126378_105226361 | 3300010361 | Tropical Forest Soil | MERFIAGLVKDFERGKLDRREFCQTVALAAVVYGAGEAANAQV |
| Ga0126378_125422451 | 3300010361 | Tropical Forest Soil | MERFIADLVQGLDNGRIDRREFCQAVALAAAVYGAGDAAQAQAPR |
| Ga0126377_101411671 | 3300010362 | Tropical Forest Soil | MGAPIREDYGMERFIADLVSSFESGKIDRRQFCETVALAATVYAAGTAATEAAPARG |
| Ga0134124_109038251 | 3300010397 | Terrestrial Soil | MERFIADLVKRFEDGKITRRQFCETVAVAATVYAAGESAANAAPTQGFKMIA |
| Ga0126383_100961694 | 3300010398 | Tropical Forest Soil | MERFIADLVKQFEGGAIDRREFCQTVALAAAVYATGDAANAQTGTGFK |
| Ga0134123_132348502 | 3300010403 | Terrestrial Soil | MERFIADLVKKYESGAINRREFCQTVTLAATVYAAGDAAHAQAP |
| Ga0137388_109705072 | 3300012189 | Vadose Zone Soil | MERCIADLVQGLDGGKIDRREFCQAVALAAAVYGAGDAAQAQAQRGFKIIG |
| Ga0137364_106081961 | 3300012198 | Vadose Zone Soil | MERFIADLVQDFESGKINRRQFCETVALAATVYAAGEEAANA |
| Ga0137382_110748271 | 3300012200 | Vadose Zone Soil | MERFIADLVKDFDSGKVDRREFCQTVALAAMVYAA |
| Ga0137399_114596411 | 3300012203 | Vadose Zone Soil | MERFIANLVKDFEAGKITRRQVCEGVAIAATVYGAGGAAK |
| Ga0137381_100845451 | 3300012207 | Vadose Zone Soil | MERFIADLVQDFESGKINRRQFCETVALAATVYAA |
| Ga0150985_1198681013 | 3300012212 | Avena Fatua Rhizosphere | MERFIADLVKKFETGAVDRREFCQTVSLAAAVYAAGDAAQAQTGT |
| Ga0137368_101366071 | 3300012358 | Vadose Zone Soil | MERFIADLVKNYESGAIDRREFCKTVALAATVYAAGDAAKA |
| Ga0137385_111155701 | 3300012359 | Vadose Zone Soil | MERFIAGLVKDFETGKMTRRQFGEAVAIAAIVYGYGTDAK |
| Ga0137360_111875371 | 3300012361 | Vadose Zone Soil | MERFIADLVKDYESGKIDRREFCKTVALAATVYAAGDTAMAQAPRG |
| Ga0137416_110124671 | 3300012927 | Vadose Zone Soil | MERFIADLVKDYESGKVDRREFCKTVALAATVYAA |
| Ga0137404_106246671 | 3300012929 | Vadose Zone Soil | MERLIADLVKKFESGAVSRREFCETVALAATVYAAGDA |
| Ga0126375_107025832 | 3300012948 | Tropical Forest Soil | MERFIADLVRNFESGRIKRRQFCEAVTLAATVYAAGDAAKAQPARGL |
| Ga0126369_100908464 | 3300012971 | Tropical Forest Soil | MERFIADLVQGLDSGKIDRREFCKSVALAAAVYGAGDAARAQVQRGFK |
| Ga0126369_101077824 | 3300012971 | Tropical Forest Soil | MERFIANLVEGLDTGAIDRREFCKAVALAAAVYGAG |
| Ga0157380_110888202 | 3300014326 | Switchgrass Rhizosphere | MERFIADLFKDFESGKVSRRQFCETVALAATVYAAGDA |
| Ga0137412_113216241 | 3300015242 | Vadose Zone Soil | MERFVAGLVDDLESGKMDRRQFCQTMALAATVYAAGETAANAAASQ |
| Ga0182041_105213511 | 3300016294 | Soil | MERFIAGLVKDYQTGRIDRREFCQTVALAAAVYGAGSAANAQNTGKGFK |
| Ga0181505_108274072 | 3300016750 | Peatland | MERFIADLVEDLDKGQIDRREFCQAVALAAAVYGAGEAAQAQEA |
| Ga0134083_103451141 | 3300017659 | Grasslands Soil | MERFIADMVQDFESGKINRRQFCETVALAATVYAAGEEAAN |
| Ga0187808_102420331 | 3300017942 | Freshwater Sediment | MERFIADLVQGLDSGKIDRREFCKSVALAAAVYGA |
| Ga0187782_113470352 | 3300017975 | Tropical Peatland | MERFIADLVKAFEAGKLSRREFCQTVALAASVYAA |
| Ga0187823_100438603 | 3300017993 | Freshwater Sediment | MERFIADLVKRFESGKMDRREFCQTVALAATVFAAGDAAHAQ |
| Ga0187787_101824242 | 3300018029 | Tropical Peatland | MERFIADLVKQFEGGAIDRREFCQTVALAAAVYAAGDAA |
| Ga0184620_100790052 | 3300018051 | Groundwater Sediment | MERFIADLVKQFEGGAIDRREFCQTVTLAAAVYAASDGLST |
| Ga0187765_109486522 | 3300018060 | Tropical Peatland | MERFIDNLVQGLDRGAIDRREFCQAMALAAAVYGVGEAAQAQASR |
| Ga0187772_110666722 | 3300018085 | Tropical Peatland | MERFIADLVRAFEAGKLSRREFCQTVALAATVYAAGDTADAQ |
| Ga0066662_113798862 | 3300018468 | Grasslands Soil | MERFIADLVKQFEGGAIDRREFCQTVALAAAAYAAGD |
| Ga0066669_105552142 | 3300018482 | Grasslands Soil | MEKFIANLVKNFESGQIDRREFCQTVALAATVYAAGDAANA |
| Ga0210403_113976361 | 3300020580 | Soil | MERFIADLVKSFESGKVDRREFCKTVALAATVYAAADAAQ |
| Ga0210401_111038251 | 3300020583 | Soil | MEQFFADLVKDFENGRINRRQFCETVALAATVYAA |
| Ga0210394_100691284 | 3300021420 | Soil | MERFVADLVKSFESGKIDRREFCQTIALAATVYAAGDAAHA |
| Ga0210394_107153362 | 3300021420 | Soil | MERFIADLVKDFDSGKVDRREFCQTVALAAVVYASGEAANA |
| Ga0126371_134774051 | 3300021560 | Tropical Forest Soil | MERFIADLVQGLDRGRIDRREFCQAVALAAAVYSAGD |
| Ga0213853_107814642 | 3300021861 | Watersheds | MERFIADLVKGFESGKLSRREFCETVALAATVYAAGDAANAQPARGFKL |
| Ga0207663_106955382 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MERFIAGLVKDFEAGKLSRREFCEAVALAAVVYGAGDAAKA |
| Ga0207700_116621182 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MERFIADLVKSFESGKLDRREFCKTVALAATVYAAGDAAQAQAP |
| Ga0207664_116801201 | 3300025929 | Agricultural Soil | MERFIAGLVKDFEAGKLSRREFCEAVALAAVVYGAGDAAKAA |
| Ga0209375_12983892 | 3300026329 | Soil | MERFIADLVKNFESGKINRRQFCETVALAATVYAAGEEAANA |
| Ga0257172_10001817 | 3300026482 | Soil | MERFIAGLVKDFERGKLDRREFCQTVALAAAVYGAGDA |
| Ga0209056_100805941 | 3300026538 | Soil | MERFIADLVQDFESGKINRRQFCETVALAATVYAAGEEAANAAPSQGFKM |
| Ga0208042_11270212 | 3300027568 | Peatlands Soil | MERFIAGLVNDFERGTVDRREFCQTVALAAVVYGAG |
| Ga0209073_102282262 | 3300027765 | Agricultural Soil | MEKFISGLVKDFEAGKITRRDFCEAVALAAIVYGAGDAANAATAKGFKM |
| Ga0209465_102303231 | 3300027874 | Tropical Forest Soil | MECFIADLVQGLDSGRIDRREFCQAVALAAAVYGAGDA |
| Ga0209465_105167702 | 3300027874 | Tropical Forest Soil | MERFIAGLVKDFESGKLDRREFCQTVALAAVVYGAGEAANAQVARGFK |
| Ga0209068_108216042 | 3300027894 | Watersheds | MERFISNLVQGLDSGEIDRREFCKAVVLAAAVYGAGD |
| Ga0209624_104025621 | 3300027895 | Forest Soil | MERFIADLVGDYERGKVDRSEFCKTVALAATVYAAGDTARAQAPRGLK |
| Ga0209488_102836721 | 3300027903 | Vadose Zone Soil | MERFIAGLVKDFESGKMDRREFCQTVALAAAVYGAGDAANAQATRGFK |
| Ga0207428_103924561 | 3300027907 | Populus Rhizosphere | MERFIADLVKDFESGKVSRRQFCETVALAATVYAAGDAAQAAPA |
| Ga0207428_109506222 | 3300027907 | Populus Rhizosphere | MERFIADLVKQFEGGAIDRREFCQTVALAAAVYAAGDAANAQTG |
| Ga0307287_101163061 | 3300028796 | Soil | MERFIADLVKQFEGGAIDRREFCQTVVLAAAVYAAGDAANAQ |
| Ga0310686_1007590032 | 3300031708 | Soil | MERFIADLVKGFESGKLSRREFCETVALAATVYAAGDAANAQPA |
| Ga0310686_1178947422 | 3300031708 | Soil | MERFIADLVKNFESGKLSRREFCETVALAATVYAAGDAANA |
| Ga0307476_108081311 | 3300031715 | Hardwood Forest Soil | MERFIAGLVKDFEAGKITRRQFCEAVALAAAVYGFGDAAKAAPARG |
| Ga0307469_104778491 | 3300031720 | Hardwood Forest Soil | MERFIADLVRNFESGRINRRQFCESVALAASVYAMGDAANAQTS |
| Ga0318521_102627271 | 3300031770 | Soil | MERFIAGLVKDFESGKVDRREFCKTVALAATVYAAGDAAQAQPTRGFKV |
| Ga0310122_103896782 | 3300031800 | Marine | VEQFIADLVKEYECGKIDRRRFCETVGIAAVVYAAGEGAANAA |
| Ga0310124_101827962 | 3300031804 | Marine | VEQFIADLVKEYECGKIDRRRFCETVGIAAVVYAAGEGAANAT |
| Ga0306925_122304322 | 3300031890 | Soil | MERFIADLVKNYESGKVNRREFCQTVALAATVYAAGDAAKAQAPRGLK |
| Ga0318536_100607231 | 3300031893 | Soil | MERFIAGLVRDFESGKVDRREFCKTIALAATVYAAGDAAEAQPARGFKV |
| Ga0306923_109250972 | 3300031910 | Soil | MERFIADLVQGLDNGRIDRREFCQAVALAAAVYGAG |
| Ga0318505_102057291 | 3300032060 | Soil | MERFIAGLVKDFESGKVDRREFCKTVALAATVYAAD |
| Ga0318553_102563813 | 3300032068 | Soil | MERFIAGLVKDFESGKVDRREFCKTVALAATVYAAGDAAQAQ |
| Ga0306920_1015535031 | 3300032261 | Soil | MERFIADLVKSFESGKMDRREFCQTVALAATVYAAGDAANAQAPSGMK |
| Ga0306920_1022601561 | 3300032261 | Soil | MERFIADLVQGLDSGKIDRREFCKAVALAAAVYGAGDAAQAQAQRGF |
| Ga0306920_1032430702 | 3300032261 | Soil | MERFIAGLVKDFEAGKITRRQFGEGVAIAATVYGFGDAAKAAPAKGMK |
| Ga0306920_1039682572 | 3300032261 | Soil | MERFIADLVRDYESGKVDRREFCKTVALAATVYAAGDAATAQA |
| Ga0310914_109485981 | 3300033289 | Soil | MERFIAGLVKDFESGKVGRREFCQTVALAAVVYGAGE |
| ⦗Top⦘ |