


| Basic Information | |
|---|---|
| Family ID | F096139 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 48 residues |
| Representative Sequence | VNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 76.19 % |
| % of genes near scaffold ends (potentially truncated) | 28.57 % |
| % of genes from short scaffolds (< 2000 bps) | 91.43 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.714 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.476 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.476 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.524 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.67% β-sheet: 0.00% Coil/Unstructured: 45.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF03100 | CcmE | 37.14 |
| PF01578 | Cytochrom_C_asm | 32.38 |
| PF03379 | CcmB | 2.86 |
| PF16327 | CcmF_C | 1.90 |
| PF04632 | FUSC | 0.95 |
| PF02272 | DHHA1 | 0.95 |
| PF13858 | DUF4199 | 0.95 |
| PF07676 | PD40 | 0.95 |
| PF01571 | GCV_T | 0.95 |
| PF01174 | SNO | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 37.14 |
| COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 2.86 |
| COG0118 | Imidazoleglycerol phosphate synthase glutamine amidotransferase subunit HisH | Amino acid transport and metabolism [E] | 0.95 |
| COG0311 | Pyridoxal 5'-phosphate synthase subunit PdxT (glutamine amidotransferase) | Coenzyme transport and metabolism [H] | 0.95 |
| COG1289 | Uncharacterized membrane protein YccC | Function unknown [S] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.71 % |
| Unclassified | root | N/A | 14.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_110655359 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300000956|JGI10216J12902_111460487 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300000956|JGI10216J12902_114467385 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300004114|Ga0062593_100945880 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300004114|Ga0062593_101993557 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300004156|Ga0062589_101547571 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300004480|Ga0062592_101156323 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300004778|Ga0062383_10691249 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005093|Ga0062594_100812929 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300005331|Ga0070670_100017870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6087 | Open in IMG/M |
| 3300005340|Ga0070689_101229454 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005354|Ga0070675_100439582 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300005364|Ga0070673_102320584 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300005365|Ga0070688_100955585 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005365|Ga0070688_101640170 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300005367|Ga0070667_101068808 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005456|Ga0070678_100185020 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
| 3300005468|Ga0070707_100674582 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300005471|Ga0070698_100469276 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300005518|Ga0070699_101132125 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005518|Ga0070699_101357596 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005536|Ga0070697_100379516 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300005564|Ga0070664_100113358 | All Organisms → cellular organisms → Bacteria | 2368 | Open in IMG/M |
| 3300005618|Ga0068864_100863851 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300005713|Ga0066905_101286654 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005841|Ga0068863_102487304 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006163|Ga0070715_10096713 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300006755|Ga0079222_11512534 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300006806|Ga0079220_11834944 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300006846|Ga0075430_101566964 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006871|Ga0075434_101655931 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300006876|Ga0079217_10843549 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300006881|Ga0068865_100860184 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300006918|Ga0079216_11616423 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300006930|Ga0079303_10514921 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300007004|Ga0079218_10135446 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300007004|Ga0079218_10143853 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
| 3300007004|Ga0079218_11487460 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300009012|Ga0066710_103499846 | Not Available | 594 | Open in IMG/M |
| 3300009094|Ga0111539_11737652 | Not Available | 723 | Open in IMG/M |
| 3300009111|Ga0115026_11531962 | Not Available | 556 | Open in IMG/M |
| 3300009156|Ga0111538_10818042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1180 | Open in IMG/M |
| 3300009177|Ga0105248_10586106 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300009553|Ga0105249_11356634 | Not Available | 783 | Open in IMG/M |
| 3300009610|Ga0105340_1365513 | Not Available | 640 | Open in IMG/M |
| 3300011400|Ga0137312_1052397 | Not Available | 677 | Open in IMG/M |
| 3300012212|Ga0150985_113210516 | Not Available | 522 | Open in IMG/M |
| 3300012212|Ga0150985_122209578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 551 | Open in IMG/M |
| 3300012910|Ga0157308_10389016 | Not Available | 538 | Open in IMG/M |
| 3300012944|Ga0137410_11029940 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300014326|Ga0157380_11221354 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300014326|Ga0157380_11483752 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300014969|Ga0157376_11498854 | Not Available | 707 | Open in IMG/M |
| 3300015201|Ga0173478_10498327 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300017965|Ga0190266_10179142 | Not Available | 989 | Open in IMG/M |
| 3300017965|Ga0190266_10232958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 909 | Open in IMG/M |
| 3300018067|Ga0184611_1078638 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300018073|Ga0184624_10352175 | Not Available | 659 | Open in IMG/M |
| 3300018081|Ga0184625_10427162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 681 | Open in IMG/M |
| 3300018422|Ga0190265_10568577 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300018476|Ga0190274_11336729 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300018481|Ga0190271_10637265 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300018481|Ga0190271_13235971 | Not Available | 546 | Open in IMG/M |
| 3300019361|Ga0173482_10265376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 738 | Open in IMG/M |
| 3300019362|Ga0173479_10663052 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 556 | Open in IMG/M |
| 3300021445|Ga0182009_10538951 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300022756|Ga0222622_10018369 | All Organisms → cellular organisms → Bacteria | 3508 | Open in IMG/M |
| 3300022880|Ga0247792_1068186 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300025905|Ga0207685_10185090 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300025918|Ga0207662_11347644 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300025922|Ga0207646_11596951 | Not Available | 563 | Open in IMG/M |
| 3300025925|Ga0207650_10027862 | All Organisms → cellular organisms → Bacteria | 4047 | Open in IMG/M |
| 3300025926|Ga0207659_10165727 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300025930|Ga0207701_11282391 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300025936|Ga0207670_10565093 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300025945|Ga0207679_10011743 | All Organisms → cellular organisms → Bacteria | 5688 | Open in IMG/M |
| 3300025960|Ga0207651_11735871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 562 | Open in IMG/M |
| 3300025986|Ga0207658_10366979 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300026023|Ga0207677_12125873 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300026075|Ga0207708_11907023 | Not Available | 521 | Open in IMG/M |
| 3300026088|Ga0207641_10946892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 856 | Open in IMG/M |
| 3300026089|Ga0207648_10891235 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300027843|Ga0209798_10547816 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300027886|Ga0209486_10020126 | All Organisms → cellular organisms → Bacteria | 3112 | Open in IMG/M |
| 3300027886|Ga0209486_10485069 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300027899|Ga0209668_10000963 | All Organisms → cellular organisms → Bacteria | 12104 | Open in IMG/M |
| 3300027909|Ga0209382_12079580 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300028812|Ga0247825_11284190 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300030336|Ga0247826_11038040 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300030336|Ga0247826_11069884 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300031834|Ga0315290_10164710 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
| 3300031854|Ga0310904_10291961 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300031997|Ga0315278_10542703 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300032144|Ga0315910_10031846 | All Organisms → cellular organisms → Bacteria | 3866 | Open in IMG/M |
| 3300032173|Ga0315268_11039654 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 826 | Open in IMG/M |
| 3300032275|Ga0315270_10416718 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300032397|Ga0315287_11294275 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300033408|Ga0316605_12490483 | Not Available | 503 | Open in IMG/M |
| 3300033418|Ga0316625_100387022 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300033433|Ga0326726_10890502 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300033482|Ga0316627_102122349 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300033488|Ga0316621_10109799 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300033550|Ga0247829_10047534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae | 2997 | Open in IMG/M |
| 3300034075|Ga0373895_049302 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300034080|Ga0373897_092360 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 8.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.71% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.76% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.86% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.90% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.90% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.90% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.90% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.95% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.95% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300011400 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034075 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A4A4.2 | Engineered | Open in IMG/M |
| 3300034080 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A5A4.1 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1106553592 | 3300000956 | Soil | VSEVLGRTIGDRIVADYVVMVVALVVWGAIFLYLMRLDRKVRELDKR* |
| JGI10216J12902_1114604872 | 3300000956 | Soil | MNEALGRTIGDRIAADYVVMVVALVVWGAVFLYLLRLDKKVRELDKR* |
| JGI10216J12902_1144673852 | 3300000956 | Soil | GERIAADYVVMVVALVVWGAVFLYLMRLDRKVRELDKR* |
| Ga0062593_1009458802 | 3300004114 | Soil | MERDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR* |
| Ga0062593_1019935572 | 3300004114 | Soil | VNELLGRPIGDRIAADYVVMVVALVVWGAVFFYLMRLERKVRELDKR* |
| Ga0062589_1015475711 | 3300004156 | Soil | RPIGDRIGADMVVMVVALVVWGAVFLYLLRLDKRVRELDKR* |
| Ga0062592_1011563231 | 3300004480 | Soil | GRAARGRRLDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGAVFLYLLRLDKRVRELDKR* |
| Ga0062383_106912491 | 3300004778 | Wetland Sediment | MNEFLGRSIGERIAADYVVMVVALVVWGAVFLYLMRLDRKVRELDKR* |
| Ga0062594_1008129292 | 3300005093 | Soil | VNELLGRPIGDRIAADYVVMVVALLVWGAVFFYLMRLERKVRELDKR* |
| Ga0070670_1000178703 | 3300005331 | Switchgrass Rhizosphere | MDRDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR* |
| Ga0070689_1012294542 | 3300005340 | Switchgrass Rhizosphere | MDRDRKGSRGVNGMLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR* |
| Ga0070675_1004395822 | 3300005354 | Miscanthus Rhizosphere | MDRDRKGSRGVNGMLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR* |
| Ga0070673_1023205841 | 3300005364 | Switchgrass Rhizosphere | VNGLLARPIGDRIGADMVVMVVALVVWGAVFLYLLRLDKRVR |
| Ga0070688_1009555852 | 3300005365 | Switchgrass Rhizosphere | LARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR* |
| Ga0070688_1016401702 | 3300005365 | Switchgrass Rhizosphere | MERDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR* |
| Ga0070667_1010688082 | 3300005367 | Switchgrass Rhizosphere | VNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLKLDHRVRELDKR* |
| Ga0070678_1001850202 | 3300005456 | Miscanthus Rhizosphere | MDRDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR* |
| Ga0070707_1006745823 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | EFLARPIGERIGADWVVMIVALVVWGAVFFYLMRLDRRVRELDKR* |
| Ga0070698_1004692763 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEDGKGSRRVNEFLARPIGERIGADWVVMIVALVVWGAVFFYLMRLDRRVRELDKR* |
| Ga0070699_1011321252 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VNEFLARPIGERIGADWVVMIVALVVWGAVFFYLMRLDRRVRELDKR* |
| Ga0070699_1013575962 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRDRKGSRGVNGFLARPIGDRIGADWVVMVVALVVWGALFLYLLRLDRRVRELDKR* |
| Ga0070697_1003795163 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LLARPIGERIGADWVVMIVALVVWGAVFFYLMRLDRRVRELDKR* |
| Ga0070664_1001133583 | 3300005564 | Corn Rhizosphere | VNGMLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR* |
| Ga0068864_1008638512 | 3300005618 | Switchgrass Rhizosphere | VNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR* |
| Ga0066905_1012866542 | 3300005713 | Tropical Forest Soil | MNEALGRTIGDRIAADYVVMIVALVVWGAVFLYLMRLDRKVRELEKR* |
| Ga0068863_1024873042 | 3300005841 | Switchgrass Rhizosphere | MERDRKGSRGVNGILARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR* |
| Ga0070715_100967133 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VNEILGRTVGERIAADWVVMIVALVVWGALFFYLMRLDRRVRELEKS* |
| Ga0079222_115125341 | 3300006755 | Agricultural Soil | LNSLLARPIGDRIGADWVVMFVALVVWGAVFFYLLRLERRVRELDKR* |
| Ga0079220_118349442 | 3300006806 | Agricultural Soil | VNQFLGRPIGDRIMADMVVMVVALVVWGAVFFYLMRLDRRVRELDKR* |
| Ga0075430_1015669642 | 3300006846 | Populus Rhizosphere | MERDRKGCCGVNGLLARPIGDRIGADMVVMVVTLVVWGALFLYLLRLDRRVRELDKR* |
| Ga0075434_1016559312 | 3300006871 | Populus Rhizosphere | MDRDRKGSCGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR* |
| Ga0079217_108435492 | 3300006876 | Agricultural Soil | MNEALGRTIGERIAADYVVMIVALVVWGAVFLYLLRLDKKVRELDKP* |
| Ga0068865_1008601843 | 3300006881 | Miscanthus Rhizosphere | RAPRGRRMDRDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR* |
| Ga0079216_116164232 | 3300006918 | Agricultural Soil | MNEVLGRTVGERIVADYVVMVVALVVWGAVFLYLMRLDRKVRELDKR* |
| Ga0079303_105149212 | 3300006930 | Deep Subsurface | VNETLGRAVGDRIVADYVVMIVALVVWGAIFLYLMKLDRKVRELDKR* |
| Ga0079218_101354463 | 3300007004 | Agricultural Soil | MNELMGRTVGERIVADYVVMTVALVVWGAVFLYLMRLDRKVRELDKR* |
| Ga0079218_101438533 | 3300007004 | Agricultural Soil | MNEALGRTIGERIAADYVVMVVALVVWGAVFLYLLRLDKKVRELDKP* |
| Ga0079218_114874603 | 3300007004 | Agricultural Soil | RLNELLGRTVGDRIVADYVVMVVALVVWGGIFLYLKRLDRKVRELDKP* |
| Ga0066710_1034998462 | 3300009012 | Grasslands Soil | VTQLLGRTVGERIVADYVVMVVALLVWAGIFFYLVRLDRRVRRLDKR |
| Ga0111539_117376523 | 3300009094 | Populus Rhizosphere | LARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR* |
| Ga0115026_115319621 | 3300009111 | Wetland | VGDRIVADYVVMIVALVVWGAIFLYLMKLDRKVRELDKR* |
| Ga0111538_108180422 | 3300009156 | Populus Rhizosphere | VNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR* |
| Ga0105248_105861061 | 3300009177 | Switchgrass Rhizosphere | VNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLKLDHR |
| Ga0105249_113566341 | 3300009553 | Switchgrass Rhizosphere | RGVNGLLARPIGDRIGADMVVMVVALVVWGAVFLYLLRLDKRVRELDKR* |
| Ga0105340_13655133 | 3300009610 | Soil | RTIGDRIVADYVVMVVALVVWGAIFLYLMRLDRKVRELDKR* |
| Ga0137312_10523971 | 3300011400 | Soil | PIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR* |
| Ga0150985_1132105162 | 3300012212 | Avena Fatua Rhizosphere | LNPILGRPIGDRIMADLVVMVVALVVWGAVFLYLMRLDRRVREIDKR* |
| Ga0150985_1222095782 | 3300012212 | Avena Fatua Rhizosphere | VNGLLARPIGDRIGADMVVMVVALVVWGAVFFYLLRLDKRVRELDKR* |
| Ga0157308_103890161 | 3300012910 | Soil | RKMIAAMVVMVVALVVWGALFLYLLRLDRRVRELDKR* |
| Ga0137410_110299402 | 3300012944 | Vadose Zone Soil | VNAFLGRPIGDRIMADAVVMVVALVVWGALFFYLMRLDKRVRELDRR* |
| Ga0157380_112213542 | 3300014326 | Switchgrass Rhizosphere | MLGRTIGERIAADYVVMAVALVCWIAVFLYLVRLERRVKELEKS* |
| Ga0157380_114837522 | 3300014326 | Switchgrass Rhizosphere | VNEVLGRTIGDRIVADYVVMVVALVVWGAIFLYLMRLDRKVRELDKR* |
| Ga0157376_114988542 | 3300014969 | Miscanthus Rhizosphere | MLARPIGDRIGADMVVMVVALVVWGALFLYLLKLDHRVRELDKR* |
| Ga0173478_104983272 | 3300015201 | Soil | VNGLLARPIGDRIGADMVVMVVARVVWGALFLYLLRLDGRVRELDKR* |
| Ga0190266_101791421 | 3300017965 | Soil | MDGDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLKLDRRVRELDKR |
| Ga0190266_102329582 | 3300017965 | Soil | VNEVLGRTIGDRIVADYVVMIVALVVWGAIFLYLMRLDRKVRELDKR |
| Ga0184611_10786382 | 3300018067 | Groundwater Sediment | VNGILARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR |
| Ga0184624_103521751 | 3300018073 | Groundwater Sediment | RMDGDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR |
| Ga0184625_104271622 | 3300018081 | Groundwater Sediment | VNGILARPIGDRIGADMVVMVVALVVWGALFLYLLKLDRRVRELDKR |
| Ga0190265_105685772 | 3300018422 | Soil | VVGHGEGSRGMNEFMGRTVGERIAADYVVMAVALVVWGAVFLYLMRLDRKVRELDKR |
| Ga0190274_113367292 | 3300018476 | Soil | VNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLKLDRRVRELDKR |
| Ga0190271_106372652 | 3300018481 | Soil | VNEVLGRTIGDRIVADYVVMVVALVVWGAVFLYLMRLDRKVRELDKR |
| Ga0190271_132359711 | 3300018481 | Soil | IGDRIVADYVVMVVALVVWGAIFLYLMRLDRKVRELDRR |
| Ga0173482_102653762 | 3300019361 | Soil | MERDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR |
| Ga0173479_106630522 | 3300019362 | Soil | MDRDRKGSRGVNGMLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR |
| Ga0182009_105389511 | 3300021445 | Soil | GDRITADLVVMVVALVVWGAVFFYLMRLDRRVRELDKR |
| Ga0222622_100183691 | 3300022756 | Groundwater Sediment | DRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR |
| Ga0247792_10681862 | 3300022880 | Soil | VNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR |
| Ga0207685_101850903 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VNEILGRTVGERIAADWVVMIVALVVWGALFFYLMRLDRRVRELEKS |
| Ga0207662_113476442 | 3300025918 | Switchgrass Rhizosphere | VNGLLARPIGDRIGADMVVMVVALVVWGAVFLYLLRLDKRVRELDKR |
| Ga0207646_115969512 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EFLARPIGERIGADWVVMIVALVVWGAVFFYLMRLDRRVRELDKR |
| Ga0207650_100278623 | 3300025925 | Switchgrass Rhizosphere | MDRDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR |
| Ga0207659_101657274 | 3300025926 | Miscanthus Rhizosphere | MDRDRKGSRGVNGMLARPIGDRIGADMVVMVVALVVWGAVFLYLLRLDKRVRELDKR |
| Ga0207701_112823912 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MDRDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR |
| Ga0207670_105650932 | 3300025936 | Switchgrass Rhizosphere | MERDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR |
| Ga0207679_100117433 | 3300025945 | Corn Rhizosphere | MDRDRKGSRGVNGMLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR |
| Ga0207651_117358712 | 3300025960 | Switchgrass Rhizosphere | MDRDRKGSRGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLKLDHRVRELDKR |
| Ga0207658_103669791 | 3300025986 | Switchgrass Rhizosphere | MDRDRKGSCGVNGLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR |
| Ga0207677_121258731 | 3300026023 | Miscanthus Rhizosphere | MERDRKGSRGVNGILARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRV |
| Ga0207708_119070231 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | GLLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRRVRELDKR |
| Ga0207641_109468922 | 3300026088 | Switchgrass Rhizosphere | VNGMLARPIGDRIGADMVVMVVALVVWGALFLYLLRLDRQVRELDKR |
| Ga0207648_108912352 | 3300026089 | Miscanthus Rhizosphere | VNELLGRPIGDRIAADYVVMVVALLVWGAVFFYLMRLERRVR |
| Ga0209798_105478162 | 3300027843 | Wetland Sediment | MNEFLGRSIGERIAADYVVMVVALVVWGAVFLYLMRLDRKVRELDKR |
| Ga0209486_100201263 | 3300027886 | Agricultural Soil | MNEALGRTIGERIAADYVVMVVALVVWGAVFLYLLRLDKKVRELDKP |
| Ga0209486_104850692 | 3300027886 | Agricultural Soil | MNELMGRTVGERIVADYVVMTVALVVWGAVFLYLMRLDRKVRELDKR |
| Ga0209668_100009634 | 3300027899 | Freshwater Lake Sediment | VNETLGRAVGDRIVADYVVMIVALVVWGAVFFYLMQLDRKVRELDKR |
| Ga0209382_120795801 | 3300027909 | Populus Rhizosphere | MNEALGRTVGERIVADYVVMVVALVVWGAVFLYLMRLDKKVRELDKR |
| Ga0247825_112841901 | 3300028812 | Soil | MNEALGRTIGERIAADYVVMVVALVVWGAVFLYLL |
| Ga0247826_110380401 | 3300030336 | Soil | MNEALGRTIGERIAADYVVMVVALVVWGAVFLYLLRLDKKVRELDK |
| Ga0247826_110698842 | 3300030336 | Soil | MERDRKGSRGVNGILARPIGDRIGADMVVMVVALVVWGALFLYLLKLDRRVRELDKR |
| Ga0315290_101647104 | 3300031834 | Sediment | VNEILGRTVGERIAADWVVMIVALVVWGALFFYLMRLDRRVRELEKP |
| Ga0310904_102919611 | 3300031854 | Soil | LLARPIGDRIGADMVVMVVALVVWGAVFLYLLRLDKRVRELDKR |
| Ga0315278_105427033 | 3300031997 | Sediment | VNEVLGRTVGDRIVADYVVMVVALVVWGALFAYLMQLDRKVRELDKR |
| Ga0315910_100318463 | 3300032144 | Soil | VNETLGRTIGDRIVADWVVMAVALVVWGAVFLYLMRLDRKVRELEKR |
| Ga0315268_110396543 | 3300032173 | Sediment | VNEILGRSVGERIAADWVVMIVALVVWGALFFYLMRLDRKVRELEKP |
| Ga0315270_104167182 | 3300032275 | Sediment | VGRNRKGSGRVNEILGRSVGERIAADWVVMIVALVVWGALFFYLMRLDRKVRELEKP |
| Ga0315287_112942752 | 3300032397 | Sediment | VNEVLGRTVGERIAADWVVMIVALVVWGALFFYLMRLDRRVRELEKP |
| Ga0316605_124904832 | 3300033408 | Soil | VNETLGRTVGDRIVADYVVMIVALVVWGAIFLYLMQLDRKVRELDKR |
| Ga0316625_1003870223 | 3300033418 | Soil | TVGDRIVADYVVMIVALVVWGAIFFYLMQLDRKVRELDKR |
| Ga0326726_108905022 | 3300033433 | Peat Soil | VNQFLGRPIGDRIMADMVVMVVALIVWGAVFFYLMRLDRRVRELDKR |
| Ga0316627_1021223492 | 3300033482 | Soil | VNETLGRTVGDRIVADYVVMIVALVVWGAIFFYLMQLDRKVRELDKR |
| Ga0316621_101097993 | 3300033488 | Soil | VNETLGRAVGDRIVADYVVMIVALVVWGAVFLYLMKLD |
| Ga0247829_100475343 | 3300033550 | Soil | MNEVLGRTIGERIAADYVVMVVALVVWGAVFLYLLRLDKKVRELDKP |
| Ga0373895_049302_3_128 | 3300034075 | Sediment Slurry | VNETLGRAVGDRIVADYVVMIVALVVWGAIFLYLMKLDRKVR |
| Ga0373897_092360_384_527 | 3300034080 | Sediment Slurry | VNETLGRAVGDRIVADYVVMIVALVVWGAIFLYLMKLDRKVRELDKR |
| ⦗Top⦘ |