


| Basic Information | |
|---|---|
| Family ID | F096117 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LVIPMLVGTVAAAMSVVIALLISPETKGKVLVAELQVA |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.71 % |
| % of genes near scaffold ends (potentially truncated) | 93.33 % |
| % of genes from short scaffolds (< 2000 bps) | 93.33 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.048 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.429 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.190 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF11775 | CobT_C | 9.52 |
| PF02633 | Creatininase | 6.67 |
| PF07690 | MFS_1 | 6.67 |
| PF01738 | DLH | 2.86 |
| PF00072 | Response_reg | 1.90 |
| PF01925 | TauE | 0.95 |
| PF08281 | Sigma70_r4_2 | 0.95 |
| PF00571 | CBS | 0.95 |
| PF04542 | Sigma70_r2 | 0.95 |
| PF01609 | DDE_Tnp_1 | 0.95 |
| PF00211 | Guanylate_cyc | 0.95 |
| PF02743 | dCache_1 | 0.95 |
| PF00005 | ABC_tran | 0.95 |
| PF02563 | Poly_export | 0.95 |
| PF00313 | CSD | 0.95 |
| PF02594 | DUF167 | 0.95 |
| PF04909 | Amidohydro_2 | 0.95 |
| PF00441 | Acyl-CoA_dh_1 | 0.95 |
| PF00483 | NTP_transferase | 0.95 |
| PF13365 | Trypsin_2 | 0.95 |
| PF13419 | HAD_2 | 0.95 |
| PF02482 | Ribosomal_S30AE | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 6.67 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.95 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.95 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.95 |
| COG1544 | Ribosome-associated translation inhibitor RaiA | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.95 |
| COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 0.95 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.95 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.95 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.95 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.95 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.95 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.95 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.95 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.90 % |
| Unclassified | root | N/A | 38.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005437|Ga0070710_10255373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1128 | Open in IMG/M |
| 3300005437|Ga0070710_11519792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 503 | Open in IMG/M |
| 3300005552|Ga0066701_10764051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 577 | Open in IMG/M |
| 3300005602|Ga0070762_10847687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 620 | Open in IMG/M |
| 3300005764|Ga0066903_102164779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1072 | Open in IMG/M |
| 3300006163|Ga0070715_10404716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 759 | Open in IMG/M |
| 3300006804|Ga0079221_10092969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1463 | Open in IMG/M |
| 3300006893|Ga0073928_10029834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5277 | Open in IMG/M |
| 3300009089|Ga0099828_11878809 | Not Available | 525 | Open in IMG/M |
| 3300009090|Ga0099827_10584627 | Not Available | 962 | Open in IMG/M |
| 3300009137|Ga0066709_102099758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 781 | Open in IMG/M |
| 3300009137|Ga0066709_104625023 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 503 | Open in IMG/M |
| 3300010043|Ga0126380_11964477 | Not Available | 534 | Open in IMG/M |
| 3300010046|Ga0126384_11468477 | Not Available | 638 | Open in IMG/M |
| 3300010049|Ga0123356_13630940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila | 534 | Open in IMG/M |
| 3300010343|Ga0074044_10134939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → environmental samples → uncultured Acetobacteraceae bacterium | 1655 | Open in IMG/M |
| 3300010361|Ga0126378_12120499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300010366|Ga0126379_12942539 | Not Available | 570 | Open in IMG/M |
| 3300010376|Ga0126381_100995952 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300010376|Ga0126381_101925812 | Not Available | 852 | Open in IMG/M |
| 3300010376|Ga0126381_102062362 | Not Available | 821 | Open in IMG/M |
| 3300010376|Ga0126381_103607438 | Not Available | 607 | Open in IMG/M |
| 3300010376|Ga0126381_103936813 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300010396|Ga0134126_10978208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 948 | Open in IMG/M |
| 3300010398|Ga0126383_13394185 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300010937|Ga0137776_1796711 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2472 | Open in IMG/M |
| 3300012189|Ga0137388_10483554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1149 | Open in IMG/M |
| 3300012189|Ga0137388_10512700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1114 | Open in IMG/M |
| 3300012208|Ga0137376_10924483 | Not Available | 749 | Open in IMG/M |
| 3300012212|Ga0150985_111683862 | Not Available | 614 | Open in IMG/M |
| 3300012349|Ga0137387_10484450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 898 | Open in IMG/M |
| 3300012362|Ga0137361_10450209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1182 | Open in IMG/M |
| 3300012363|Ga0137390_10947774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 814 | Open in IMG/M |
| 3300012948|Ga0126375_11677113 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300012971|Ga0126369_10703155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1088 | Open in IMG/M |
| 3300012971|Ga0126369_12657083 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300013770|Ga0120123_1002692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3317 | Open in IMG/M |
| 3300014501|Ga0182024_12414748 | Not Available | 569 | Open in IMG/M |
| 3300015372|Ga0132256_102917431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 575 | Open in IMG/M |
| 3300016270|Ga0182036_10704019 | Not Available | 817 | Open in IMG/M |
| 3300016294|Ga0182041_11388396 | Not Available | 644 | Open in IMG/M |
| 3300016387|Ga0182040_11724021 | Not Available | 535 | Open in IMG/M |
| 3300016404|Ga0182037_11109402 | Not Available | 692 | Open in IMG/M |
| 3300018062|Ga0187784_10109993 | Not Available | 2246 | Open in IMG/M |
| 3300018482|Ga0066669_11593271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300020583|Ga0210401_11104023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
| 3300021178|Ga0210408_11124402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Glaciimonas → Glaciimonas immobilis | 603 | Open in IMG/M |
| 3300021402|Ga0210385_11277515 | Not Available | 563 | Open in IMG/M |
| 3300021476|Ga0187846_10481513 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 508 | Open in IMG/M |
| 3300021560|Ga0126371_11389492 | Not Available | 833 | Open in IMG/M |
| 3300021861|Ga0213853_11063228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 521 | Open in IMG/M |
| 3300022508|Ga0222728_1125671 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300022529|Ga0242668_1109039 | Not Available | 571 | Open in IMG/M |
| 3300022530|Ga0242658_1150040 | Not Available | 600 | Open in IMG/M |
| 3300022840|Ga0224549_1039980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300025320|Ga0209171_10217191 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300025933|Ga0207706_10779753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
| 3300025939|Ga0207665_11529191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300025949|Ga0207667_11465256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300025960|Ga0207651_10739140 | Not Available | 869 | Open in IMG/M |
| 3300027783|Ga0209448_10055707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1329 | Open in IMG/M |
| 3300027874|Ga0209465_10027612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2656 | Open in IMG/M |
| 3300027874|Ga0209465_10085159 | Not Available | 1542 | Open in IMG/M |
| 3300027882|Ga0209590_11071354 | Not Available | 500 | Open in IMG/M |
| 3300027884|Ga0209275_10207822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1061 | Open in IMG/M |
| 3300030973|Ga0075395_11372469 | Not Available | 583 | Open in IMG/M |
| 3300031058|Ga0308189_10009223 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300031128|Ga0170823_16013183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 770 | Open in IMG/M |
| 3300031446|Ga0170820_14297725 | Not Available | 1134 | Open in IMG/M |
| 3300031545|Ga0318541_10046211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2219 | Open in IMG/M |
| 3300031564|Ga0318573_10479819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300031564|Ga0318573_10712773 | Not Available | 539 | Open in IMG/M |
| 3300031573|Ga0310915_10631028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300031573|Ga0310915_11059290 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300031679|Ga0318561_10605250 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300031744|Ga0306918_11573602 | Not Available | 501 | Open in IMG/M |
| 3300031779|Ga0318566_10060919 | Not Available | 1810 | Open in IMG/M |
| 3300031793|Ga0318548_10531163 | Not Available | 574 | Open in IMG/M |
| 3300031797|Ga0318550_10481762 | Not Available | 599 | Open in IMG/M |
| 3300031833|Ga0310917_10747908 | Not Available | 661 | Open in IMG/M |
| 3300031846|Ga0318512_10234609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 903 | Open in IMG/M |
| 3300031894|Ga0318522_10076447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1218 | Open in IMG/M |
| 3300031897|Ga0318520_10179556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1241 | Open in IMG/M |
| 3300031912|Ga0306921_12383248 | Not Available | 553 | Open in IMG/M |
| 3300031942|Ga0310916_11725064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
| 3300031954|Ga0306926_12412691 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300031954|Ga0306926_12423880 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300031959|Ga0318530_10136576 | Not Available | 991 | Open in IMG/M |
| 3300031959|Ga0318530_10254218 | Not Available | 724 | Open in IMG/M |
| 3300031959|Ga0318530_10292831 | Not Available | 672 | Open in IMG/M |
| 3300032001|Ga0306922_12264878 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotalea → unclassified Candidatus Nitrosotalea → Candidatus Nitrosotalea sp. FS | 522 | Open in IMG/M |
| 3300032039|Ga0318559_10543791 | Not Available | 542 | Open in IMG/M |
| 3300032042|Ga0318545_10027912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1835 | Open in IMG/M |
| 3300032043|Ga0318556_10022376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2846 | Open in IMG/M |
| 3300032055|Ga0318575_10727194 | Not Available | 502 | Open in IMG/M |
| 3300032059|Ga0318533_10323704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1121 | Open in IMG/M |
| 3300032059|Ga0318533_11217088 | Not Available | 551 | Open in IMG/M |
| 3300032065|Ga0318513_10111138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1289 | Open in IMG/M |
| 3300032065|Ga0318513_10149926 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri | 1112 | Open in IMG/M |
| 3300032068|Ga0318553_10419578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 701 | Open in IMG/M |
| 3300032076|Ga0306924_10615590 | Not Available | 1227 | Open in IMG/M |
| 3300032076|Ga0306924_10747599 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300032076|Ga0306924_12281042 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300032805|Ga0335078_11558557 | Not Available | 734 | Open in IMG/M |
| 3300032828|Ga0335080_12314135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.43% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.43% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.86% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.90% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.95% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.95% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.95% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.95% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.95% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.95% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.95% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.95% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070710_102553732 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | YQVGLVIPMLVGTCAAAVSVVIALLISPETKGKELVPDLIVA* |
| Ga0070710_115197921 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GYAIPMLVGTVAAAVSVVIALSLSPETKGKVLVAELSVA* |
| Ga0066701_107640512 | 3300005552 | Soil | MLVGTVVAAISVVISLLLSPETKGKVLVAELQVA* |
| Ga0070762_108476872 | 3300005602 | Soil | MGYAIPMLVGTVAAAVSVVIALSLSPETKGKVLVAELSVA* |
| Ga0066903_1021647792 | 3300005764 | Tropical Forest Soil | LGFAIPMLVSTVIAAASVVISLLLSPETKGKVLVPDLVVA* |
| Ga0070715_104047162 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | NYQVGLVIPMLVGTCAAATSVVIALLISPETKGKELMADLVVT* |
| Ga0079221_100929691 | 3300006804 | Agricultural Soil | PMLVGTVLAAASVVVSLLLSPETKGKVLVAELSVA* |
| Ga0073928_100298346 | 3300006893 | Iron-Sulfur Acid Spring | VPVVLAFCAEYFQVGLVIPMLVGTVAAAFSVVVALLLSPETKGQELSAELVVA* |
| Ga0099828_118788091 | 3300009089 | Vadose Zone Soil | AEFYQVGLVTPMLVGTVVAASSVVVALLISPETKGKVLEAELSIA* |
| Ga0099827_105846271 | 3300009090 | Vadose Zone Soil | MGYGTPMLVATVAAATSVVIALSLSPETKGQELTADLVVAGADD* |
| Ga0066709_1020997583 | 3300009137 | Grasslands Soil | GYAVPMQVGTVVAAFSVVIALLVSPETKGKELVAELVVA* |
| Ga0066709_1046250232 | 3300009137 | Grasslands Soil | PMLVGTVAAAVSVVIALSLSPETKGKVLVAELQVA* |
| Ga0126380_119644771 | 3300010043 | Tropical Forest Soil | PMLVSTVIAATSVVISLLLSPETKGKVLVSDLVVA* |
| Ga0126384_114684771 | 3300010046 | Tropical Forest Soil | LEHVADRQLLVSTVVAAASVVISLLLSPETKGKVLVSDLVVA* |
| Ga0123356_136309401 | 3300010049 | Termite Gut | GYVVPMLVGTVAAAISFAIAVLVGPETKGKAMVADVVVA* |
| Ga0074044_101349392 | 3300010343 | Bog Forest Soil | EYYQVGLVIPMLVGTVAAAVSVVISLLISPETKGKVLVAELQVA* |
| Ga0126378_121204992 | 3300010361 | Tropical Forest Soil | FHLGLVTPMLVGTVAAATSVVIALLVSPETKGKILEAELSIA* |
| Ga0126379_129425391 | 3300010366 | Tropical Forest Soil | IPMLVGTVVAAASVVISLLLSPETKGTVLVAELSVA* |
| Ga0126381_1009959521 | 3300010376 | Tropical Forest Soil | SLGYAIPMLVGTVVAAASVVIALLLSPETKGKALVAELQVA* |
| Ga0126381_1019258121 | 3300010376 | Tropical Forest Soil | IPMLVGTVVAAVSVVISLLLSPETKGKALLAELSVA* |
| Ga0126381_1020623621 | 3300010376 | Tropical Forest Soil | PMLVGTVGAAASVVVALLLSPETKGKELTAELVVA* |
| Ga0126381_1036074381 | 3300010376 | Tropical Forest Soil | LTFCAEYFQVGLVVPMLIATVAAATSVVIALLISPETKGTVLVAELQVARSGTLSGGLT* |
| Ga0126381_1039368131 | 3300010376 | Tropical Forest Soil | MLVGTVGAAASVVVALLLSPKTKGKELTAELVVA* |
| Ga0134126_109782082 | 3300010396 | Terrestrial Soil | YAVPMLVGTVVAAFSVVIALLLSPETKGKELVADLVVA* |
| Ga0126383_133941852 | 3300010398 | Tropical Forest Soil | MLVSTVIAATSVVISLLLSPETKGKVLVSDLVVA* |
| Ga0137776_17967112 | 3300010937 | Sediment | MLVGTVLGAVSFVCSLFVSPETKGKVLVPDLLLA* |
| Ga0137388_104835541 | 3300012189 | Vadose Zone Soil | TPMLVGTVAAAVSVVIALSLSPETKGQELSADLVVAGADD* |
| Ga0137388_105127001 | 3300012189 | Vadose Zone Soil | MRHAPPMLVGPVAPAVSLVLALSPSPETRGQELPADLVVAGADD* |
| Ga0137376_109244831 | 3300012208 | Vadose Zone Soil | AVNYGLGYGTPMLVGTVAAATSVVIALSLSPETKGQELTADLVVAGADD* |
| Ga0150985_1116838622 | 3300012212 | Avena Fatua Rhizosphere | MLVGTVAAAISVVIALSLSPETKGKVLVADLSVA* |
| Ga0137387_104844503 | 3300012349 | Vadose Zone Soil | MLLGTVIAAASVVVALLLSPETKGQELTADLVVA* |
| Ga0137361_104502093 | 3300012362 | Vadose Zone Soil | FGLGYGTPMLVGTVAAATSVVIALSLSPETKGQELTADLVVAGADD* |
| Ga0137390_109477741 | 3300012363 | Vadose Zone Soil | PMLVGTVAAAVSVVIALSLSPETKGQELTADLVVAGADD* |
| Ga0126375_116771132 | 3300012948 | Tropical Forest Soil | MLVSTVIAAASVVISLLLSPETKGKVLVSDLVLA* |
| Ga0126369_107031551 | 3300012971 | Tropical Forest Soil | MLVGTVVAAVSVVISLLLSPETKGKALLAELSVA* |
| Ga0126369_126570831 | 3300012971 | Tropical Forest Soil | MLVGTVAAATSVVIALLVSPETKGKVLEAELSIA* |
| Ga0120123_10026924 | 3300013770 | Permafrost | QMGYGLPMAAGTIVAAVSVVIALLLSPETMGQELTADLVVAGADD* |
| Ga0182024_124147482 | 3300014501 | Permafrost | YNVSFAVPMLIGTVVAASSVVVALLISPETKGKELVSELLVA* |
| Ga0132256_1029174311 | 3300015372 | Arabidopsis Rhizosphere | VIPMLVGTCAAATSVVIALLISPETKGKELMADLVVT* |
| Ga0182036_107040193 | 3300016270 | Soil | GLVIPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA |
| Ga0182041_113883963 | 3300016294 | Soil | LTFCAEYFQVGLVVPMLIATVTAATSVVIALLISPETKGTVFVAELQVA |
| Ga0182040_117240212 | 3300016387 | Soil | FLAEYFQVGLVIPMLVGTVAAATSVVIALLISPETKGTVLVADLQVA |
| Ga0182037_111094021 | 3300016404 | Soil | QVGLVIPMLVGTVAAATSVVIALLISPETKGTVLVADLQVA |
| Ga0187784_101099935 | 3300018062 | Tropical Peatland | FKVGLVAPMLVGTVGAAASVVISLLLSPETKGKELTAELVVA |
| Ga0066669_115932711 | 3300018482 | Grasslands Soil | VGYAIPMAVGTVVAAVSVVIALSLSPETKGQELVADLVTV |
| Ga0210401_111040232 | 3300020583 | Soil | VIPMLVGTVAAAISVVVSLLISPETKGKVLVAELQVA |
| Ga0210408_111244022 | 3300021178 | Soil | AEYFHAGLVIPMLVGTVAAAASVVIALLLSPETKGKTLTAELVVA |
| Ga0210385_112775151 | 3300021402 | Soil | IPMLVGTVAAAVSVVIALSLNPETKGKVLVAELSVA |
| Ga0187846_104815131 | 3300021476 | Biofilm | IPMLVGTVVAAISVVISLLLSPETKGKVLVAELQVA |
| Ga0126371_113894921 | 3300021560 | Tropical Forest Soil | YFQVGLVVPMLIATVAAATSVVIALLISPETKGTVLVAELQVA |
| Ga0213853_110632282 | 3300021861 | Watersheds | SIPMLIGTCIGALSVAIALLLSPETKGKELTAELQIA |
| Ga0222728_11256711 | 3300022508 | Soil | QVGLVIPMLVGTVGASASVVTALLLSPETKGKELTAELVVA |
| Ga0242668_11090391 | 3300022529 | Soil | VNYDMGYAIPMLGGTVAAAVSVGIALSLSPETKGKVLVAELQVA |
| Ga0242658_11500402 | 3300022530 | Soil | YAIPMLVGTVAAAVSVVIALSLSPETKGKVLVAELQVA |
| Ga0224549_10399801 | 3300022840 | Soil | VPVVLAFCSDYFGVGLVIPMLVGTVGAAASVVVSLLLSPETRGKELTSELVVA |
| Ga0209171_102171912 | 3300025320 | Iron-Sulfur Acid Spring | FVPVVLAFCAEYFQVGLVIPMLVGTVAAAFSVVVALLLSPETKGQELSAELVVA |
| Ga0207706_107797533 | 3300025933 | Corn Rhizosphere | ALPMFVGTVVAAVSVVIALSLSPETKGKELVADLAPA |
| Ga0207665_115291911 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | YAVPMLVGTVVAAFSVVIALLLSPETKGKELVADLVVA |
| Ga0207667_114652562 | 3300025949 | Corn Rhizosphere | AVPMLVGTVVAAFSVVIALLLSPETKGKELVADLVVA |
| Ga0207651_107391402 | 3300025960 | Switchgrass Rhizosphere | GYAVPMLVGTVFAAFSVVIALSLSPETKGKELVSDLVVA |
| Ga0209448_100557071 | 3300027783 | Bog Forest Soil | EYYQVGLVIPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA |
| Ga0209465_100276122 | 3300027874 | Tropical Forest Soil | LAIPMMVGTAVGAGSFIIALLLSPETKGKVLVPDLQVA |
| Ga0209465_100851591 | 3300027874 | Tropical Forest Soil | AEHYQLGLVTPMLVGTVAAASSVVIALLISPETRGKVLEAELQVA |
| Ga0209590_110713542 | 3300027882 | Vadose Zone Soil | AVNYGMGYGTPMLIATVAAATSVVIALSLSPETKGQELTADLVVAGADD |
| Ga0209275_102078221 | 3300027884 | Soil | PMAAGTIAAAVSVVIALLLSPETMGQELTADLVVAGADD |
| Ga0075395_113724691 | 3300030973 | Soil | PMLVGTVVAAISVVISLLLSPETKGKVLVAELQVA |
| Ga0308189_100092233 | 3300031058 | Soil | RLRHPMLAGTLVGAVGIVVSLLISPETKGKELEADLVVA |
| Ga0170823_160131831 | 3300031128 | Forest Soil | PMLAGTVVAAISVVISLLLSPETKGTVLMAELQVA |
| Ga0170820_142977252 | 3300031446 | Forest Soil | YNLGYAIPMLVGTVSAAVSVVIALSLSPETKGEVLVAELQVA |
| Ga0318541_100462111 | 3300031545 | Soil | VIPMLAGTVIAASSVVVALLISPETKGKILEAELSVA |
| Ga0318573_104798192 | 3300031564 | Soil | PMLVGTVAAAVSVVISLLISPETKGKILVAELQVA |
| Ga0318573_107127731 | 3300031564 | Soil | YYQVGLVIPMLVGTVAAATSVVIALLISPETKGKVLVAELQVA |
| Ga0310915_106310281 | 3300031573 | Soil | VPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA |
| Ga0310915_110592902 | 3300031573 | Soil | LVIPMLVGTVAAAMSVVIALLISPETKGKVLVAELQVA |
| Ga0318561_106052501 | 3300031679 | Soil | FLAEYFQVGLVIPMLVGTVAAAMSVVIALLISPETKGKVLVAELQVA |
| Ga0306918_115736022 | 3300031744 | Soil | LVLTFLAEYYQVGLVIPMLIGTVAAATSVVIALLISPETKGTVLVSELQVA |
| Ga0318566_100609191 | 3300031779 | Soil | YFQVGLVVPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA |
| Ga0318548_105311632 | 3300031793 | Soil | IPMLVGTVVAAASVVISLLLSPETKGTVLVAELSVA |
| Ga0318550_104817621 | 3300031797 | Soil | LVIPMLIGTVAAATSVVIALLISPETKGTVLVSELQVA |
| Ga0310917_107479081 | 3300031833 | Soil | QVGLVIPMLVGTVAAATSVVIALLISPETKGTVLVSELQVA |
| Ga0318512_102346091 | 3300031846 | Soil | PMLVGTVVAAVSVVISLLLSPETKGKALLAELSVA |
| Ga0318522_100764471 | 3300031894 | Soil | EYYQVGLVIPMLVGTVAAATSVVIALLISPETKGTVLVAELQVA |
| Ga0318520_101795561 | 3300031897 | Soil | VGLVIPMLIGTVAAAVSVVISLLISPETKGKVLVAELQVA |
| Ga0306921_123832481 | 3300031912 | Soil | VIPMLVGTVAAATSVVIALLISPETKGTVLVADLQVA |
| Ga0310916_117250641 | 3300031942 | Soil | YQVGLVIPMLVGTVAAATSVVIALLISPETKGTVLVADLQVA |
| Ga0306926_124126911 | 3300031954 | Soil | AEYFQVGLVIPMLVGTVAAAMSVVIALLISPETKGKVLVAELQVA |
| Ga0306926_124238802 | 3300031954 | Soil | FCAEFFQVGLVIPMMVGTVGAAASVVIALLLSPETKGKELTAELQVA |
| Ga0318530_101365761 | 3300031959 | Soil | PMLVGTVVAAISVVIALLLSPETKGKVLVAELQVA |
| Ga0318530_102542181 | 3300031959 | Soil | YYQVGLVIPMLIGTVAAAVSVVISLLISPETKGKVLVAELQVA |
| Ga0318530_102928311 | 3300031959 | Soil | YQIGLVIPMLVGTVAAAMSVVIALLISPETKGKVLVAELQVA |
| Ga0306922_122648781 | 3300032001 | Soil | VIPMLVGTVAAATSVVIALLISPETKGTVLVAELQVA |
| Ga0318559_105437911 | 3300032039 | Soil | VGLVIPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA |
| Ga0318545_100279123 | 3300032042 | Soil | FFAEYFQVGLVIPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA |
| Ga0318556_100223763 | 3300032043 | Soil | PMLIGTVAAAVSVVISLLISPETKGKVLVAELQVA |
| Ga0318575_107271941 | 3300032055 | Soil | PMLVGTVVAAVSVVISLLLSPETKGKVLVAELQVA |
| Ga0318533_103237043 | 3300032059 | Soil | VGLVVPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA |
| Ga0318533_112170881 | 3300032059 | Soil | YDQVGLVIPMLVGTVAAATSVVIALLISPETKGKVLVAELQVA |
| Ga0318513_101111381 | 3300032065 | Soil | YFQVGLVIPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA |
| Ga0318513_101499262 | 3300032065 | Soil | EYYQVGLVIPMLIGTVAAAVSVVISLLISPETKGKVLVAELQVA |
| Ga0318553_104195782 | 3300032068 | Soil | GLVVPMLVGTVAAAVSVVISLLISPETKGKILVAELQVA |
| Ga0306924_106155902 | 3300032076 | Soil | IGLVIPMLVGTVAAAMSVVIALLISPETKGKVLVAELQVA |
| Ga0306924_107475992 | 3300032076 | Soil | IPMLAGTVIAASSVVVALLISPETKGKILEAELSVA |
| Ga0306924_122810422 | 3300032076 | Soil | IAIPMLVSTVVAAVSVVISLLLSPETKGKVLVADLAVA |
| Ga0335078_115585572 | 3300032805 | Soil | VLAASAEYFQIGLVIPMLVGTVGAGASVVVASRLSPETKGRELTA |
| Ga0335080_123141351 | 3300032828 | Soil | AEYFQVGLVIPMMVGTVGAAASVVIALLLSPETKGKELTAELVVA |
| ⦗Top⦘ |