


| Basic Information | |
|---|---|
| Family ID | F096111 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKRTWMWCLIGLLSFGSVAWSQAQTTGGTEKAVAALEQQWLQS |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.24 % |
| % of genes near scaffold ends (potentially truncated) | 93.33 % |
| % of genes from short scaffolds (< 2000 bps) | 88.57 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.905 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.619 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF00589 | Phage_integrase | 3.81 |
| PF14534 | DUF4440 | 2.86 |
| PF08843 | AbiEii | 1.90 |
| PF00903 | Glyoxalase | 1.90 |
| PF01593 | Amino_oxidase | 1.90 |
| PF01402 | RHH_1 | 1.90 |
| PF08327 | AHSA1 | 1.90 |
| PF10067 | DUF2306 | 1.90 |
| PF00719 | Pyrophosphatase | 0.95 |
| PF13432 | TPR_16 | 0.95 |
| PF03795 | YCII | 0.95 |
| PF13426 | PAS_9 | 0.95 |
| PF00080 | Sod_Cu | 0.95 |
| PF05170 | AsmA | 0.95 |
| PF13180 | PDZ_2 | 0.95 |
| PF05173 | DapB_C | 0.95 |
| PF03544 | TonB_C | 0.95 |
| PF01609 | DDE_Tnp_1 | 0.95 |
| PF03237 | Terminase_6N | 0.95 |
| PF00266 | Aminotran_5 | 0.95 |
| PF01740 | STAS | 0.95 |
| PF06271 | RDD | 0.95 |
| PF01939 | NucS | 0.95 |
| PF06884 | DUF1264 | 0.95 |
| PF07719 | TPR_2 | 0.95 |
| PF13936 | HTH_38 | 0.95 |
| PF00069 | Pkinase | 0.95 |
| PF00881 | Nitroreductase | 0.95 |
| PF00291 | PALP | 0.95 |
| PF07689 | KaiB | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.81 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 1.90 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.95 |
| COG0289 | 4-hydroxy-tetrahydrodipicolinate reductase | Amino acid transport and metabolism [E] | 0.95 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG1637 | Endonuclease NucS, RecB family | Replication, recombination and repair [L] | 0.95 |
| COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.95 |
| COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.95 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.95 |
| COG2982 | Uncharacterized conserved protein AsmA involved in outer membrane biogenesis | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.95 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.95 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.95 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.90 % |
| Unclassified | root | N/A | 38.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0639387 | Not Available | 611 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101629823 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300001154|JGI12636J13339_1036621 | Not Available | 634 | Open in IMG/M |
| 3300005175|Ga0066673_10186593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1176 | Open in IMG/M |
| 3300005175|Ga0066673_10878642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300005179|Ga0066684_10945328 | Not Available | 560 | Open in IMG/M |
| 3300005332|Ga0066388_100740613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1584 | Open in IMG/M |
| 3300005436|Ga0070713_100536857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1106 | Open in IMG/M |
| 3300005436|Ga0070713_100598752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1047 | Open in IMG/M |
| 3300005437|Ga0070710_10925383 | Not Available | 631 | Open in IMG/M |
| 3300005467|Ga0070706_100670005 | Not Available | 963 | Open in IMG/M |
| 3300005467|Ga0070706_100751397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 903 | Open in IMG/M |
| 3300005471|Ga0070698_101853388 | Not Available | 556 | Open in IMG/M |
| 3300005526|Ga0073909_10467784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300005537|Ga0070730_10009547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8039 | Open in IMG/M |
| 3300005549|Ga0070704_100193692 | Not Available | 1636 | Open in IMG/M |
| 3300005554|Ga0066661_10542931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300005561|Ga0066699_10457858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 913 | Open in IMG/M |
| 3300005563|Ga0068855_101968198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300005598|Ga0066706_11060267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300006028|Ga0070717_11197955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300006032|Ga0066696_10708806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300006163|Ga0070715_10491778 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300006163|Ga0070715_10510014 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 690 | Open in IMG/M |
| 3300006173|Ga0070716_100437409 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300006173|Ga0070716_100725037 | Not Available | 762 | Open in IMG/M |
| 3300006174|Ga0075014_100947930 | Not Available | 518 | Open in IMG/M |
| 3300006175|Ga0070712_100937469 | Not Available | 747 | Open in IMG/M |
| 3300006175|Ga0070712_101821729 | Not Available | 533 | Open in IMG/M |
| 3300006794|Ga0066658_10270972 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300006796|Ga0066665_10997839 | Not Available | 642 | Open in IMG/M |
| 3300006854|Ga0075425_102462976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300006881|Ga0068865_100809809 | Not Available | 809 | Open in IMG/M |
| 3300006893|Ga0073928_10044352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4075 | Open in IMG/M |
| 3300007076|Ga0075435_100919060 | Not Available | 763 | Open in IMG/M |
| 3300009012|Ga0066710_101466879 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 1055 | Open in IMG/M |
| 3300009038|Ga0099829_10089734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2371 | Open in IMG/M |
| 3300009038|Ga0099829_10733759 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300009089|Ga0099828_10353808 | Not Available | 1323 | Open in IMG/M |
| 3300009089|Ga0099828_10487943 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300009162|Ga0075423_10562584 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300010401|Ga0134121_11351251 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300011270|Ga0137391_10983618 | Not Available | 687 | Open in IMG/M |
| 3300012096|Ga0137389_10389795 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300012096|Ga0137389_11255496 | Not Available | 634 | Open in IMG/M |
| 3300012189|Ga0137388_10339844 | Not Available | 1383 | Open in IMG/M |
| 3300012189|Ga0137388_10946352 | Not Available | 796 | Open in IMG/M |
| 3300012201|Ga0137365_10809559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300012202|Ga0137363_11238474 | Not Available | 633 | Open in IMG/M |
| 3300012205|Ga0137362_10101406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2424 | Open in IMG/M |
| 3300012207|Ga0137381_11683610 | Not Available | 525 | Open in IMG/M |
| 3300012211|Ga0137377_11006915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300012349|Ga0137387_10012720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5004 | Open in IMG/M |
| 3300012349|Ga0137387_10290117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1182 | Open in IMG/M |
| 3300012359|Ga0137385_10914369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300012362|Ga0137361_10523486 | Not Available | 1089 | Open in IMG/M |
| 3300012582|Ga0137358_10402690 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300012917|Ga0137395_11060813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300015054|Ga0137420_1025477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2382 | Open in IMG/M |
| 3300017659|Ga0134083_10006620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3733 | Open in IMG/M |
| 3300018016|Ga0187880_1326907 | Not Available | 655 | Open in IMG/M |
| 3300018026|Ga0187857_10037946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2538 | Open in IMG/M |
| 3300018431|Ga0066655_10267927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1099 | Open in IMG/M |
| 3300020580|Ga0210403_10912371 | Not Available | 692 | Open in IMG/M |
| 3300020583|Ga0210401_11423979 | Not Available | 550 | Open in IMG/M |
| 3300021170|Ga0210400_10483611 | Not Available | 1022 | Open in IMG/M |
| 3300021171|Ga0210405_10828013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300021180|Ga0210396_11583127 | Not Available | 536 | Open in IMG/M |
| 3300021344|Ga0193719_10239484 | Not Available | 769 | Open in IMG/M |
| 3300021401|Ga0210393_11038255 | Not Available | 663 | Open in IMG/M |
| 3300021432|Ga0210384_10234076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1653 | Open in IMG/M |
| 3300021475|Ga0210392_10386915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1017 | Open in IMG/M |
| 3300021559|Ga0210409_10277499 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300024330|Ga0137417_1321557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
| 3300024331|Ga0247668_1005289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2768 | Open in IMG/M |
| 3300025320|Ga0209171_10394127 | Not Available | 711 | Open in IMG/M |
| 3300025906|Ga0207699_10120415 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300025910|Ga0207684_10447210 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300025916|Ga0207663_10166818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1560 | Open in IMG/M |
| 3300025916|Ga0207663_11123173 | Not Available | 632 | Open in IMG/M |
| 3300025949|Ga0207667_11868833 | Not Available | 563 | Open in IMG/M |
| 3300026318|Ga0209471_1063305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1676 | Open in IMG/M |
| 3300026333|Ga0209158_1007334 | All Organisms → cellular organisms → Bacteria | 5705 | Open in IMG/M |
| 3300027061|Ga0209729_1031830 | Not Available | 656 | Open in IMG/M |
| 3300027535|Ga0209734_1056367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 744 | Open in IMG/M |
| 3300027663|Ga0208990_1148218 | Not Available | 622 | Open in IMG/M |
| 3300027671|Ga0209588_1234823 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300027846|Ga0209180_10105454 | Not Available | 1609 | Open in IMG/M |
| 3300027857|Ga0209166_10001747 | All Organisms → cellular organisms → Bacteria | 17487 | Open in IMG/M |
| 3300027895|Ga0209624_10413263 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300031057|Ga0170834_103631197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300031234|Ga0302325_12171657 | Not Available | 677 | Open in IMG/M |
| 3300031474|Ga0170818_112703602 | Not Available | 1717 | Open in IMG/M |
| 3300031715|Ga0307476_10279237 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300031715|Ga0307476_11005605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300031718|Ga0307474_10477194 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300031718|Ga0307474_10945039 | Not Available | 682 | Open in IMG/M |
| 3300031718|Ga0307474_11282498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300031753|Ga0307477_10011218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6138 | Open in IMG/M |
| 3300031754|Ga0307475_10196558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1611 | Open in IMG/M |
| 3300031823|Ga0307478_10651147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 882 | Open in IMG/M |
| 3300031908|Ga0310900_11857813 | Not Available | 513 | Open in IMG/M |
| 3300031945|Ga0310913_10768704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
| 3300031962|Ga0307479_11819959 | Not Available | 560 | Open in IMG/M |
| 3300032180|Ga0307471_103962542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 17.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 9.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.86% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.90% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.90% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_06393871 | 2228664022 | Soil | MKRALLCSLIGFVLLSSAASSRAQTTGDTEKAVAALEQQWLQS |
| INPhiseqgaiiFebDRAFT_1016298232 | 3300000364 | Soil | MKRTLLCCLIGFVLLSSAALSQAQTTEGTEKAVAALE |
| JGI12636J13339_10366211 | 3300001154 | Forest Soil | MKRTWILCLIGLLSLGSAAWSQAQTTGGTEKAVAALEQQWL |
| Ga0066673_101865933 | 3300005175 | Soil | MNRTWMWCLVGLLSFGSAALSQNSTAGSGTEKAVAALEQQWLQ |
| Ga0066673_108786421 | 3300005175 | Soil | MKRTLILYLVGLLSWGIATRSQAQTTGGTEKAVAAREQQWLQSQKI |
| Ga0066684_109453281 | 3300005179 | Soil | MKRTWMWCLIGLLSFASVAWSQAQTTGGTEKAVAALEQQWLQ |
| Ga0066388_1007406131 | 3300005332 | Tropical Forest Soil | MTKSLMWCLVGLLLLGSASWSQAQTIGETEKAVAALEQQW |
| Ga0070713_1005368572 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRTWMWCLVGLLSLGSAALSQDSTAGSGTEKAVAALEQQWLQSQ |
| Ga0070713_1005987522 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRTWMWCLIGLLSLGSAAWSQDKKASGGTEKAVAALEQQWLQ |
| Ga0070710_109253832 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLWMGCLIGVLLMGTAALSRAQKTGATEKAVAALEEQWLQAQ |
| Ga0070706_1006700051 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKSLMWCLIGLLSLGSAARSQAQTNSGTEKAVAALEQQWLQSQKTNN |
| Ga0070706_1007513972 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRFWTVCLIVLLSLGSASLLQAQTGTEKSVAALEQQWLQSQKTN |
| Ga0070698_1018533881 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRFWTVCLIVLLSLGSASLLQAQTGTEKSVAALEQQWLQSQKT |
| Ga0073909_104677842 | 3300005526 | Surface Soil | MKRTWMWCLIGLLSLGSAAWSQDKKDGGGTEKAVAA |
| Ga0070730_100095474 | 3300005537 | Surface Soil | MWCLVGLSQDSTAGGGTEKAVAALEQQWLQIAEDK* |
| Ga0070704_1001936922 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKTLTWCLLGLFSLGSAAWSQDKQPGGGTEKAVAVLEQQWLQSQKT |
| Ga0066661_105429311 | 3300005554 | Soil | MKRTWMWCLVGLLSLGSAALSQDSTAGSGTEKAVAALEQQWLQSQKTNNP |
| Ga0066699_104578583 | 3300005561 | Soil | MKRTWMWCLIGLFSLGSTAWSQNEQAGGGTEKAVAALEQQWLQSQK |
| Ga0068855_1019681981 | 3300005563 | Corn Rhizosphere | MSKTSIWCLVGLLSLVSAALSQDSTAGNGTEKAVAALEQQWLQS |
| Ga0066706_110602672 | 3300005598 | Soil | MKSTWMWCLISLLSVGSAAWSQDKKPDGGTEKAVAALEQQWLQS* |
| Ga0070717_111979551 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRFWTVCLIVLLSLGSASLLQAQTGTEKSVAALEQQWLQSQK |
| Ga0066696_107088061 | 3300006032 | Soil | MFMNRTWMWCLVGLLSFGSAALSQNSTAGSGTEKAVAALEQQWLQSQKTNNP |
| Ga0070715_104917783 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKTLMWCLIGLISLGSAARSQAQQTGATEKAVAALEEQWLQSQK |
| Ga0070715_105100141 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRTWILFLAGLFSLGIATRSQAQTTGGTEKAVAA |
| Ga0070716_1004374091 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKTWMWCLIGVLLLGSAARSQAQTNGGTEKAVAA |
| Ga0070716_1007250372 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRTWMWCLVGLLSLGSAALSEGMQAGGGTEKAVAALEQQWLQSQ |
| Ga0075014_1009479301 | 3300006174 | Watersheds | MKKIMMWCLIGLLSLVSVAWSQTQMTGGTEKAVAALEQQWIQAMKSNN |
| Ga0070712_1009374691 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKTCTFFLVGLLSLVAAVSARAQTTGGTEKAVAALEQQWLQSQ |
| Ga0070712_1018217291 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRTWMWCLVGLFSVGSTGLSQEKRTGGGTEKAVAALEQQW |
| Ga0066658_102709723 | 3300006794 | Soil | MNRNWTWCLIGVLLLASAGWSKDKNAGGGTEDAVAALEQKWPQSQK |
| Ga0066665_109978391 | 3300006796 | Soil | MKKSLMWCLIGLLSLASAARSQAQANGGTEKAVAALEQ |
| Ga0075425_1024629762 | 3300006854 | Populus Rhizosphere | MKRMWMWCLVGLLSLGSAALSQDNSARSGTEKAVAALEQQWLQSQKTN |
| Ga0068865_1008098092 | 3300006881 | Miscanthus Rhizosphere | MKKLWMGCLIGVLLLGSAARSHAQKTGATEKAVAAL |
| Ga0073928_100443527 | 3300006893 | Iron-Sulfur Acid Spring | MKRTLTWCLVGFVLLVSTAWSQAQMTGGTEKAVAAL |
| Ga0075435_1009190601 | 3300007076 | Populus Rhizosphere | MKKTLMCCLIGLLSLGSAAWLQAQQTGGTEKAVAALEQQWLQSQK |
| Ga0066710_1014668792 | 3300009012 | Grasslands Soil | MKRTWTWCLIGLLALGSAAWSQDKKTGGGTEKAVAALEQQWLQ |
| Ga0099829_100897343 | 3300009038 | Vadose Zone Soil | MKRTWMWCLIGLLSFGSVAWSQAQTTGGTEKAVAALEQQWLQS |
| Ga0099829_107337591 | 3300009038 | Vadose Zone Soil | MKRTWISSLIGLLLLGSAAWSQAQRPGGTEKAVAA |
| Ga0099828_103538081 | 3300009089 | Vadose Zone Soil | MKKTLMWCLICFFLLGNAAWSQAQTTGGTERAVAALEQQ |
| Ga0099828_104879431 | 3300009089 | Vadose Zone Soil | MKRTWILCVIGLLSLGSAAWSQAQTTGGTEKAVAA |
| Ga0075423_105625842 | 3300009162 | Populus Rhizosphere | MWCLISLLSVGSAAWSQAQTTGATEKAVAALEQQWLQSQKTNNP |
| Ga0134121_113512512 | 3300010401 | Terrestrial Soil | MKRTWLWCLIALLSVGTAAWSQNASGGTEKAVAALEQQWLQS |
| Ga0137391_109836181 | 3300011270 | Vadose Zone Soil | MKKTLMWCLIGLLSLGSAARSQAQQTGATEKAVAALEEQ |
| Ga0137389_103897951 | 3300012096 | Vadose Zone Soil | MKKTGIWCLLVLLLLLSAAWSQNKQSGSGTEKAVAALEQQ |
| Ga0137389_112554962 | 3300012096 | Vadose Zone Soil | VKKTWIWCSLVLLSVVSAAWSQAQTTGGIEKAVAALEQ |
| Ga0137388_103398442 | 3300012189 | Vadose Zone Soil | MKKTFMWCLSTLLLLGSAAWLQAQQTGATEKAVAALE |
| Ga0137388_109463522 | 3300012189 | Vadose Zone Soil | MKKTLMWCLICFFLLGNAAWSQAQTTGGTERAVAALEQHWLQSQ |
| Ga0137365_108095591 | 3300012201 | Vadose Zone Soil | MKRTCILFIVALLSLVSAASAQAQTTGGTEKAVAALEQQWL |
| Ga0137363_112384741 | 3300012202 | Vadose Zone Soil | MWCLIGLLSFGSVAWSQAQTTGGTEKAVAALEQQW |
| Ga0137362_101014064 | 3300012205 | Vadose Zone Soil | MKKTLMWCFIGLLSLGSVAWSQAQTTGGTEKAVAALEQQ* |
| Ga0137381_116836101 | 3300012207 | Vadose Zone Soil | MKKSLMWCLIGLLSLGSAARSQAQTNGATEKAVAALEQQWL |
| Ga0137377_110069152 | 3300012211 | Vadose Zone Soil | MWCLVGLLSFGSAALSQDSTAGSGTEKALAALEQQWLQSQKT |
| Ga0137387_100127204 | 3300012349 | Vadose Zone Soil | MKKTWMWCLIGVLLLGSTARSQAQMTGGTEKAAAALEEQ* |
| Ga0137387_102901172 | 3300012349 | Vadose Zone Soil | MKRTCILFIVALLSLVSAASAQAQTTGGTEKAVAALEQQWLQSQ |
| Ga0137385_109143693 | 3300012359 | Vadose Zone Soil | GMAMKKTWMWCLIGVLLLGSTARSQAQMTGGTEKAAAALEEQ* |
| Ga0137361_105234861 | 3300012362 | Vadose Zone Soil | MWCLVALLSLGSFAWSQAGGGAEKAVAALEQQWLQSQKTN |
| Ga0137358_104026903 | 3300012582 | Vadose Zone Soil | MWCLISLLSLGSAAWLQAQQIGGTEKAVAALEQQWLQSQ |
| Ga0137395_110608131 | 3300012917 | Vadose Zone Soil | MWFLISLLSVGSAAWAQDKKAGGGTEKAVAALEQQWLQSQKTNNPD |
| Ga0137420_10254771 | 3300015054 | Vadose Zone Soil | MKRTWILCLIGLFYLGSVASSQAQQTGGIEKAVAALEEQWLQSQKKQWL |
| Ga0134083_100066201 | 3300017659 | Grasslands Soil | MKSAWMWFLISLLSVGSAAWAQDKKAGGGTEKAVAALEQQWLQS |
| Ga0187880_13269071 | 3300018016 | Peatland | MKKTWMSCLVGLLLVGSLAWSQDKKAGGGTEKAVAALE |
| Ga0187857_100379463 | 3300018026 | Peatland | MKKSLMWGLLGFCLLVSAAWSQAQKTGETEKAIVALEQQWQE |
| Ga0066655_102679273 | 3300018431 | Grasslands Soil | MKKTWMWCLIGVLLLGSAARSPAQTTGGTEKTVAALEEQWLQAQKTN |
| Ga0210403_109123711 | 3300020580 | Soil | MKKSLMWCLVGLLSLGSAAWSQAQTNGGTEKAVAALEQQWLESQKTNN |
| Ga0210401_114239791 | 3300020583 | Soil | MKKSLMWCLVGLLSLGSAAWSQAQTTGGTEKAVATLEQQWLESQKT |
| Ga0210400_104836111 | 3300021170 | Soil | MKKSLMWCLVGLLSLGSAAWSQAQTNGGTEKAVAALEQQ |
| Ga0210405_108280131 | 3300021171 | Soil | MDRTWTWCLIAVLSLASAAWSQEKKAGGTEGAVAALEQQ |
| Ga0210396_115831271 | 3300021180 | Soil | MKRICIVCVMVLFSLGSAALSQAQATGATAKNVAALEQQWLQSQKTN |
| Ga0193719_102394841 | 3300021344 | Soil | MKRTWMWCLIGLVSLASALSQEGGTEKAVAALEQQ |
| Ga0210393_110382551 | 3300021401 | Soil | MKKLWMGCLIGVLLLGSAARSHAQNTGATEKAVAALEEQ |
| Ga0210384_102340761 | 3300021432 | Soil | MNRTWTWCLIAVLSLASAAWSQEKKAGGTEGAVAALEQQWLQS |
| Ga0210392_103869153 | 3300021475 | Soil | MKKMLMFCLVCLISLGSAAWSQAQQTGGAEKAVAALEEQ |
| Ga0210409_102774991 | 3300021559 | Soil | MKRTWIWCLIGLFSFGNAARLQAQTTDGTEKAVAALEQQWLQSQ |
| Ga0137417_13215573 | 3300024330 | Vadose Zone Soil | MKKTLIWCFLGLLSLMSAAWSQAQQTSETEKAVAALEEKWLQA |
| Ga0247668_10052891 | 3300024331 | Soil | MKKTLMWCFIGLLSLGSAAWSQAQTTSGTEKAVAALEQQWLQSQKTNN |
| Ga0209171_103941272 | 3300025320 | Iron-Sulfur Acid Spring | MKKTLMWCFIGLLSLGSAAWSQAQTTGGTEKSVAALEDQ |
| Ga0207699_101204151 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRTWMWCLVGLFLLGNAAWSQDKMGGDTEKAVVAL |
| Ga0207684_104472102 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKTLMWCLIGLISLGSAARSQAQQTGATEKAVAALEE |
| Ga0207663_101668181 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKTLMWCLIGLISLGSATRSQAQQTGATEKAVAALEEQWLQSQKTN |
| Ga0207663_111231731 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKTLVWCFIGLLSLGSAAWSQAQTTGGTEKAVAALEQQWL |
| Ga0207667_118688332 | 3300025949 | Corn Rhizosphere | MKRIWLWCLIALLSVGNAAWSQDSSGGTEKAVTALEQQWLQSQKT |
| Ga0209471_10633051 | 3300026318 | Soil | MKKTWMWCLVGLLSLVSSAFSQDKQAGGGTEKAVAALEQQWLQSQKTNNP |
| Ga0209158_10073346 | 3300026333 | Soil | MKRTLILYLVGLLSWGIATRSQAQTTGGTEKAVAAREQQWLQSQKINN |
| Ga0209729_10318301 | 3300027061 | Forest Soil | MKRTWMWCLIGLLSLGSVAWAQAQKTGGIEKAVAAQEE |
| Ga0209734_10563671 | 3300027535 | Forest Soil | MKRTWMWCLVALLSLGTTMRLQAQTTGGTEKAVAALEQQWVQS |
| Ga0208990_11482181 | 3300027663 | Forest Soil | MKKTWMWCLVGVLLLGSAARSQAQMTGGTEKAVAALEQ |
| Ga0209588_12348231 | 3300027671 | Vadose Zone Soil | MKRTWISSLIGLLLLGSAAWSQAQRPGGTEKAVAALEQQWLQSQ |
| Ga0209180_101054541 | 3300027846 | Vadose Zone Soil | MKRTWMWCLIGLLSFGSVAWSQAQTTGGTEKAVAALEQQWLQSQKTNN |
| Ga0209166_100017479 | 3300027857 | Surface Soil | MWCLVGLSQDSTAGGGTEKAVAALEQQWLQIAEDK |
| Ga0209624_104132632 | 3300027895 | Forest Soil | MWCLAGLLSMGSAAWLQDNKASGTEKAVAALEQQWL |
| Ga0170834_1036311971 | 3300031057 | Forest Soil | MKKILMWCLIGLISVGSAARSQAQQTGATEKAVAALEEQWLQSQKTNNPEQ |
| Ga0302325_121716571 | 3300031234 | Palsa | MRRIVASCFLGLVLLAGCAWSQAQTGTEKAVAALEEQWLK |
| Ga0170818_1127036021 | 3300031474 | Forest Soil | MKRTWLWCLIAVVSVGNAAWSSDAKGGTEKAVAALEQQWLQ |
| Ga0307476_102792371 | 3300031715 | Hardwood Forest Soil | VKKTWMWCLIGLLSLGSAALSRAQETGGTEKAVAALE |
| Ga0307476_110056052 | 3300031715 | Hardwood Forest Soil | MNRTWMWCLIGLISLGSAALSQAQTTGDTEKTVAALEQKWLEA |
| Ga0307474_104771941 | 3300031718 | Hardwood Forest Soil | MKKLWMGCLIGVLLLGSAARSHAQNTGATEKAVAALEEQWLQAQ |
| Ga0307474_109450391 | 3300031718 | Hardwood Forest Soil | MKRTWMWCVIGLLSLGSVAWAQAQKTGGIEKAVAAQEE |
| Ga0307474_112824981 | 3300031718 | Hardwood Forest Soil | MRKVWMWCLIGMLSLGSAAMAPAQQAGETEKVVAALENQWLQ |
| Ga0307477_100112181 | 3300031753 | Hardwood Forest Soil | MKRTWMWCLVGLLSLGSVAWAQDKQAGGGTEKAVAALEQQWLQS |
| Ga0307475_101965583 | 3300031754 | Hardwood Forest Soil | MKRTWMWCLIGLLSLGSVAWAQAQKTGGIEKAVAAQEEQWLQAM |
| Ga0307478_106511472 | 3300031823 | Hardwood Forest Soil | MKKTLMWCLIGLLSLGSVARSQAQQTGATEKAVAALE |
| Ga0310900_118578132 | 3300031908 | Soil | MKKLWMWCLIGVLLLGSAASSYAQKTGATEKAVAALEEKWLQAQKTNN |
| Ga0310913_107687041 | 3300031945 | Soil | DVDLIGVLLLGSAARSQAQTTGGTERAVVALEEQWLQETKDK |
| Ga0307479_118199591 | 3300031962 | Hardwood Forest Soil | MKRTWMWCLIGLLSLGSAAWSQAQTTGGTEKAVAALEEQWLQALKTNNPD |
| Ga0307471_1039625422 | 3300032180 | Hardwood Forest Soil | MKRTWMWCLIGLLSLGSAAWSQDKKASGGTEKAVAALEQQWLQSQKTN |
| ⦗Top⦘ |