


| Basic Information | |
|---|---|
| Family ID | F096100 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MINQMRDHQMKILQAYIDRRNRLWVQIKAAYPTYTQPEIEARLEQFGA |
| Number of Associated Samples | 76 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 71.84 % |
| % of genes near scaffold ends (potentially truncated) | 22.86 % |
| % of genes from short scaffolds (< 2000 bps) | 78.10 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.238 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.143 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.571 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.32% β-sheet: 0.00% Coil/Unstructured: 48.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF02775 | TPP_enzyme_C | 13.33 |
| PF13570 | PQQ_3 | 12.38 |
| PF03401 | TctC | 6.67 |
| PF04214 | DUF411 | 6.67 |
| PF02776 | TPP_enzyme_N | 4.76 |
| PF04909 | Amidohydro_2 | 2.86 |
| PF00486 | Trans_reg_C | 1.90 |
| PF01979 | Amidohydro_1 | 1.90 |
| PF01011 | PQQ | 0.95 |
| PF04392 | ABC_sub_bind | 0.95 |
| PF07969 | Amidohydro_3 | 0.95 |
| PF13360 | PQQ_2 | 0.95 |
| PF00990 | GGDEF | 0.95 |
| PF03466 | LysR_substrate | 0.95 |
| PF02786 | CPSase_L_D2 | 0.95 |
| PF00753 | Lactamase_B | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG3019 | Uncharacterized metal-binding protein, DUF411 family | Function unknown [S] | 6.67 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 6.67 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.24 % |
| Unclassified | root | N/A | 44.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001686|C688J18823_10646901 | Not Available | 673 | Open in IMG/M |
| 3300004281|Ga0066397_10055999 | Not Available | 726 | Open in IMG/M |
| 3300004633|Ga0066395_10466901 | Not Available | 722 | Open in IMG/M |
| 3300004778|Ga0062383_10282241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis | 792 | Open in IMG/M |
| 3300004780|Ga0062378_10000944 | All Organisms → cellular organisms → Bacteria | 3469 | Open in IMG/M |
| 3300005180|Ga0066685_10874753 | Not Available | 602 | Open in IMG/M |
| 3300005332|Ga0066388_100012640 | All Organisms → cellular organisms → Bacteria | 6772 | Open in IMG/M |
| 3300005332|Ga0066388_100292659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2272 | Open in IMG/M |
| 3300005332|Ga0066388_100314574 | All Organisms → cellular organisms → Bacteria | 2211 | Open in IMG/M |
| 3300005332|Ga0066388_101807753 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300005332|Ga0066388_103249270 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300005332|Ga0066388_103946516 | Not Available | 757 | Open in IMG/M |
| 3300005332|Ga0066388_105214469 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005440|Ga0070705_100530005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 899 | Open in IMG/M |
| 3300005569|Ga0066705_10534266 | Not Available | 730 | Open in IMG/M |
| 3300005713|Ga0066905_100003899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5995 | Open in IMG/M |
| 3300005713|Ga0066905_100093972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2014 | Open in IMG/M |
| 3300005713|Ga0066905_100499920 | Not Available | 1010 | Open in IMG/M |
| 3300005764|Ga0066903_103031015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 910 | Open in IMG/M |
| 3300005833|Ga0074472_10013189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 1026 | Open in IMG/M |
| 3300005833|Ga0074472_10027928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9460 | Open in IMG/M |
| 3300005833|Ga0074472_10223488 | All Organisms → cellular organisms → Bacteria | 2212 | Open in IMG/M |
| 3300005880|Ga0075298_1036320 | Not Available | 516 | Open in IMG/M |
| 3300005937|Ga0081455_10325627 | Not Available | 1093 | Open in IMG/M |
| 3300005983|Ga0081540_1140247 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300006163|Ga0070715_10728145 | Not Available | 595 | Open in IMG/M |
| 3300006804|Ga0079221_11186272 | Not Available | 592 | Open in IMG/M |
| 3300006806|Ga0079220_11902288 | Not Available | 528 | Open in IMG/M |
| 3300006845|Ga0075421_102393916 | Not Available | 553 | Open in IMG/M |
| 3300009012|Ga0066710_101476290 | Not Available | 1050 | Open in IMG/M |
| 3300009090|Ga0099827_10307049 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300009094|Ga0111539_10118247 | All Organisms → cellular organisms → Bacteria | 3106 | Open in IMG/M |
| 3300009137|Ga0066709_100220628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2511 | Open in IMG/M |
| 3300009143|Ga0099792_10063437 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300009147|Ga0114129_13090451 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300009803|Ga0105065_1080483 | Not Available | 516 | Open in IMG/M |
| 3300010043|Ga0126380_10167222 | Not Available | 1431 | Open in IMG/M |
| 3300010043|Ga0126380_10773034 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300010046|Ga0126384_11246751 | Not Available | 688 | Open in IMG/M |
| 3300010046|Ga0126384_11808703 | Not Available | 580 | Open in IMG/M |
| 3300010046|Ga0126384_12290621 | Not Available | 521 | Open in IMG/M |
| 3300010047|Ga0126382_10157347 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300010358|Ga0126370_11426954 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300010359|Ga0126376_10219540 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1592 | Open in IMG/M |
| 3300010359|Ga0126376_13109406 | Not Available | 513 | Open in IMG/M |
| 3300010360|Ga0126372_10841592 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300010360|Ga0126372_11378040 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300010360|Ga0126372_12365887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Tardiphaga → Tardiphaga robiniae | 581 | Open in IMG/M |
| 3300010362|Ga0126377_10018490 | All Organisms → cellular organisms → Bacteria | 5680 | Open in IMG/M |
| 3300010362|Ga0126377_10115626 | Not Available | 2470 | Open in IMG/M |
| 3300010362|Ga0126377_11825595 | Not Available | 683 | Open in IMG/M |
| 3300010362|Ga0126377_13580808 | Not Available | 502 | Open in IMG/M |
| 3300010362|Ga0126377_13593389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Tardiphaga → Tardiphaga robiniae | 502 | Open in IMG/M |
| 3300010397|Ga0134124_10045049 | All Organisms → cellular organisms → Bacteria | 3697 | Open in IMG/M |
| 3300010397|Ga0134124_12577482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 551 | Open in IMG/M |
| 3300010398|Ga0126383_12386354 | Not Available | 614 | Open in IMG/M |
| 3300010400|Ga0134122_10322898 | Not Available | 1334 | Open in IMG/M |
| 3300012199|Ga0137383_11168606 | Not Available | 554 | Open in IMG/M |
| 3300012203|Ga0137399_11576149 | Not Available | 545 | Open in IMG/M |
| 3300012206|Ga0137380_11501452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
| 3300012210|Ga0137378_11657405 | Not Available | 547 | Open in IMG/M |
| 3300012349|Ga0137387_11117649 | Not Available | 560 | Open in IMG/M |
| 3300012359|Ga0137385_10222284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1643 | Open in IMG/M |
| 3300012361|Ga0137360_11034093 | Not Available | 709 | Open in IMG/M |
| 3300012582|Ga0137358_10670287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 694 | Open in IMG/M |
| 3300012922|Ga0137394_10027402 | All Organisms → cellular organisms → Bacteria | 4610 | Open in IMG/M |
| 3300012924|Ga0137413_11161622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 614 | Open in IMG/M |
| 3300012924|Ga0137413_11651561 | Not Available | 525 | Open in IMG/M |
| 3300012930|Ga0137407_10828331 | Not Available | 874 | Open in IMG/M |
| 3300012930|Ga0137407_11461963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 650 | Open in IMG/M |
| 3300012971|Ga0126369_13250800 | Not Available | 532 | Open in IMG/M |
| 3300012989|Ga0164305_12079086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300013297|Ga0157378_11184749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 803 | Open in IMG/M |
| 3300014969|Ga0157376_10076146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2866 | Open in IMG/M |
| 3300015241|Ga0137418_10314344 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300015264|Ga0137403_10013254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9012 | Open in IMG/M |
| 3300017947|Ga0187785_10712234 | Not Available | 528 | Open in IMG/M |
| 3300018028|Ga0184608_10016112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2640 | Open in IMG/M |
| 3300018066|Ga0184617_1080935 | Not Available | 881 | Open in IMG/M |
| 3300018076|Ga0184609_10330479 | Not Available | 712 | Open in IMG/M |
| 3300018433|Ga0066667_10705451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 847 | Open in IMG/M |
| 3300018468|Ga0066662_11687408 | Not Available | 662 | Open in IMG/M |
| 3300020170|Ga0179594_10089469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1095 | Open in IMG/M |
| 3300020170|Ga0179594_10171879 | Not Available | 807 | Open in IMG/M |
| 3300021073|Ga0210378_10294071 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300021078|Ga0210381_10069533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 1095 | Open in IMG/M |
| 3300022756|Ga0222622_11221251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 553 | Open in IMG/M |
| 3300026088|Ga0207641_12194476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis | 552 | Open in IMG/M |
| 3300027273|Ga0209886_1024449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 910 | Open in IMG/M |
| 3300027383|Ga0209213_1039889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium | 887 | Open in IMG/M |
| 3300027646|Ga0209466_1013597 | Not Available | 1714 | Open in IMG/M |
| 3300027646|Ga0209466_1087733 | Not Available | 628 | Open in IMG/M |
| 3300027716|Ga0209682_10007910 | All Organisms → cellular organisms → Bacteria | 2720 | Open in IMG/M |
| 3300027874|Ga0209465_10425498 | Not Available | 664 | Open in IMG/M |
| 3300027903|Ga0209488_10005798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9451 | Open in IMG/M |
| 3300027907|Ga0207428_10061821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2963 | Open in IMG/M |
| 3300028536|Ga0137415_10138538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2273 | Open in IMG/M |
| 3300031184|Ga0307499_10053257 | Not Available | 998 | Open in IMG/M |
| 3300031184|Ga0307499_10128440 | Not Available | 723 | Open in IMG/M |
| 3300031198|Ga0307500_10010313 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300031198|Ga0307500_10043641 | Not Available | 1061 | Open in IMG/M |
| 3300031740|Ga0307468_100112038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1654 | Open in IMG/M |
| 3300031740|Ga0307468_100931741 | Not Available | 757 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 19.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 15.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.81% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.86% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.86% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.90% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300005880 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J18823_106469012 | 3300001686 | Soil | MINQMRDHQMKILQAYIDRRNRLWAQIRATYPNYTQPQIEARLEQFGV* |
| Ga0066397_100559992 | 3300004281 | Tropical Forest Soil | MINQMRDKQLKILQAYIDRRNRLWVQIKTANPTYTQFEIEARLEQFGA* |
| Ga0066395_104669012 | 3300004633 | Tropical Forest Soil | MINQMHDKQLKILQAYIDRRNRLWAQIKAANPTYTQLDVEARLEQFGA* |
| Ga0062383_102822412 | 3300004778 | Wetland Sediment | EGSMINQMREFKHSKILQAYIDRRNRLWAQIRVAHPTYTPLDIEARLEQLGA* |
| Ga0062378_100009443 | 3300004780 | Wetland Sediment | MINQMREFKHSKILQAYIDRRNRLWAQIRVAHPTYTPLDIEARLEQLGA* |
| Ga0066685_108747531 | 3300005180 | Soil | MINQMRDKQLKILQAYIERRNRLWVQIKTANPTYTQFDIEARLEQFGA* |
| Ga0066388_1000126403 | 3300005332 | Tropical Forest Soil | MINQMRDKQLKILQAYIDRRNRLWEQIKIANPTYTQVDIEARLEQFGA* |
| Ga0066388_1002926591 | 3300005332 | Tropical Forest Soil | MINQMRDHQMKILQAYIDRRNRLWAQIKAAHPSYTQPEIEARLEQFGA* |
| Ga0066388_1003145742 | 3300005332 | Tropical Forest Soil | MINQMRDYQTKILQSHIDRRNRLWAQIKAAHPSYTLPEIEARLEQFGA* |
| Ga0066388_1018077532 | 3300005332 | Tropical Forest Soil | MINQMRDKQLKILQAYIERRNRLWEQIKVANPSYTQIEVEARLEQFGA* |
| Ga0066388_1032492702 | 3300005332 | Tropical Forest Soil | MINQMRDQQMKILQAYIERRNRLWAQIKAANPTYTQFDIEARLEQFGA* |
| Ga0066388_1039465161 | 3300005332 | Tropical Forest Soil | MINQMRDQQMKILQAYVDRRNRLWAQVKAAHPSYTQPEIEARLEQFGA* |
| Ga0066388_1052144691 | 3300005332 | Tropical Forest Soil | SIELEGSMINQMRDQQMKILQAYVDRRNRLWAQIKATHPTYTQPEIEARLEQFGA* |
| Ga0070705_1005300051 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MINQMRDHHMKILQAYIDRRNRLWAQIKAAYPTYSQPEIEARLEQFGA* |
| Ga0066705_105342662 | 3300005569 | Soil | MINQMRDHQMKTLQAYIDRRNRLWAQIKSTYPTYTQTEIEARLEQFGA* |
| Ga0066905_1000038992 | 3300005713 | Tropical Forest Soil | MINQMRDKQLKILQAYIERRNRLWEQIKVANPTYTQIEVEARLEQFGA* |
| Ga0066905_1000939722 | 3300005713 | Tropical Forest Soil | MIKMRQSWQSKTLQAFIDRRNRLWAQVKADHPAYTQAEIEARMEQFGA* |
| Ga0066905_1004999202 | 3300005713 | Tropical Forest Soil | MINQMRDKQLKVLQAYIERRNRLWVQIKTANPTYTQFDIEARLEQFGA* |
| Ga0066903_1030310152 | 3300005764 | Tropical Forest Soil | MINQMRDQQMKILQAYIDRRNRLWAQIKATHPTYSQPEIEARLEQFGA* |
| Ga0074472_100131892 | 3300005833 | Sediment (Intertidal) | MINQMRERQWKILQASIDRRNRLWAQLRAAHPSFTPVEIEARLEQLGA* |
| Ga0074472_100279283 | 3300005833 | Sediment (Intertidal) | MINQMREFKHSKILQAYIDRRNRLWAQIRVANPTYTQHDIEARLEQLGA* |
| Ga0074472_102234882 | 3300005833 | Sediment (Intertidal) | MINQVREYKQSKMLQAHIDRRNRLWAQVRAAYPTYSQAEIEARLEQFGA* |
| Ga0075298_10363201 | 3300005880 | Rice Paddy Soil | MINQMRERQLKILRAYVERRNRLWSQVRIANPTFTQLQVEARLEQFGA* |
| Ga0081455_103256272 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MINQMRDKQLKVLQAYIERRNRLWEQIKVANPTYTQIEVEARLEQFGA* |
| Ga0081540_11402471 | 3300005983 | Tabebuia Heterophylla Rhizosphere | AYIDRRIRLWAQIKAAHPTYSQPEIEARLEQFGA* |
| Ga0070715_107281451 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MINQMRDHQMKILQAYIDRRNRLWAQIKAAYPTYSQPEIEARLEQFGA* |
| Ga0079221_111862721 | 3300006804 | Agricultural Soil | IELEGSMINQMRDHQMKILQAYIDRRNRLWSQIKAAHPSYTQPEIEARLEQFGA* |
| Ga0079220_119022881 | 3300006806 | Agricultural Soil | MINQMRDHHMKILQAYIDRRNRLWALIKAAHPSYTQPEIEARLEQFGA* |
| Ga0075421_1023939161 | 3300006845 | Populus Rhizosphere | MINQMRDHQMKILQAYIDRRNRLWAQIKAAHPTYSQPEIEARLEQFGA* |
| Ga0066710_1014762902 | 3300009012 | Grasslands Soil | MINQMRDKQLKILQAYIERRNRLWVQIKTANPTYTQFDIEARLEQFGA |
| Ga0099827_103070492 | 3300009090 | Vadose Zone Soil | VSIELEGSMINQMRDHQMKILQAYIDRRNRLWAQIKAAYPTYTQPEIEARLEQFGV* |
| Ga0111539_101182472 | 3300009094 | Populus Rhizosphere | MINQMRDHQMKILQAYIDRRNRLWTQIKAAHPTFTQPEIEARLEQFGA* |
| Ga0066709_1002206281 | 3300009137 | Grasslands Soil | MINQMRDHQMKILQAYIDRRNRLWAQIKATYPTYTQPEIEARLEQFGA* |
| Ga0099792_100634372 | 3300009143 | Vadose Zone Soil | MINQMRDHQMKILQAYIDRRNRLWAQIKAACPTYTQPEIEARLEQFGV* |
| Ga0114129_130904511 | 3300009147 | Populus Rhizosphere | RARVSIELEGSMINQMRDHQMKILQAYIDRRNRLWTQIKAAHPTFTQPEIEARLEQFGA* |
| Ga0105065_10804831 | 3300009803 | Groundwater Sand | MRESTQSKILQTYIDRRNRLWVQVKAANPTYTLGQVEARLEQLGA* |
| Ga0126380_101672221 | 3300010043 | Tropical Forest Soil | MINQMRDHQIKILQAHIDRRNRLWAQIKTAYPSYTQPEIEARLEQFGA* |
| Ga0126380_107730342 | 3300010043 | Tropical Forest Soil | MINQMRDHQLKILQAYIDRRNRLWVQIKAANPAYTQPEIEARLEQFGA* |
| Ga0126384_112467511 | 3300010046 | Tropical Forest Soil | MINQMRDHQMKILQAHIDRRNRLWAQIKTAHPSYTQPEIEARLEQFGA* |
| Ga0126384_118087031 | 3300010046 | Tropical Forest Soil | SIELEGSMINQMRDKQLKILQAYIERRNRLWEQIKVANPTYTQLDIEARLEQFGA* |
| Ga0126384_122906211 | 3300010046 | Tropical Forest Soil | SNLEGSMINQMRDHQMKILQAYIDRRNRLWTQIKAAHPTYTQPEIEARLEQFGA* |
| Ga0126382_101573472 | 3300010047 | Tropical Forest Soil | MINQMRDHQLKILQAYIDRRNRLWVQIKAANPAYTQPEIEARLEQFGV* |
| Ga0126370_114269541 | 3300010358 | Tropical Forest Soil | MINQMHDKQLKILQAYIDRRNRLWAQIKTANPTYTQFELEARLEQFGA* |
| Ga0126370_118039752 | 3300010358 | Tropical Forest Soil | MINQMRDRQMKILQAHIDRRNRLWAQIKTAYPSYT |
| Ga0126376_102195401 | 3300010359 | Tropical Forest Soil | MVNKRDHSQKRLQAYIERRNRLWVQIKAAHPAFTPAEIDARLEVFGA* |
| Ga0126376_131094061 | 3300010359 | Tropical Forest Soil | MIKVRQSWQSKTLQAFIDRRNRLWAQVKADHPAYTQAEIEARMEQFGA* |
| Ga0126372_108415922 | 3300010360 | Tropical Forest Soil | MINQMRDQQIKILQAYIERRNRLWAQIKAANPTYTQFDIEARLEQFGA* |
| Ga0126372_113780402 | 3300010360 | Tropical Forest Soil | MINQMRDQLKILQAYIDRRNRLWAQIKAAHPSYTQPEIEARLEQFGA* |
| Ga0126372_123658871 | 3300010360 | Tropical Forest Soil | MINQMRDQQMKILQAYIDRRNRLWAQIKATHPSYTQPEIEARLEQFGA* |
| Ga0126377_100184906 | 3300010362 | Tropical Forest Soil | FEDLVSNARVRLSIELEGSMINQMRDKQLKILQAYIERRNRLWEQIKVANPSYTQIEVEARLEQFGA* |
| Ga0126377_101156262 | 3300010362 | Tropical Forest Soil | NFISNARARVSIELEGSMINQMRDHQMKILQVHIDRRNRLWAQIKTAHPSYTQPEIEARLEQFGA* |
| Ga0126377_118255951 | 3300010362 | Tropical Forest Soil | MINQMRDKQLKILQAYIERRNRLWEQIKIANPTYTQVDIEARLEQFGV* |
| Ga0126377_135808081 | 3300010362 | Tropical Forest Soil | QLKILQAYIDRRNRLWVQIKTANPTYTQFEIEARLEQFGA* |
| Ga0126377_135933892 | 3300010362 | Tropical Forest Soil | NARARVSIELEGSMINQMRDHQMKILQAYIDRRNRLWAQIKAAHPSYTQPEIEARLEQFGA* |
| Ga0134124_100450491 | 3300010397 | Terrestrial Soil | GFHFDSFGSNARARVSIELEGSMINQMRDHHMKILQAYIDRRNRLWAQIKAAYPTYSQPEIEARLEQFGA* |
| Ga0134124_125774822 | 3300010397 | Terrestrial Soil | LQAYIDRRNRLWAQIKAAYPTYSQPEIEARLEQFGA* |
| Ga0126383_123863541 | 3300010398 | Tropical Forest Soil | QMRDKQLKILQAYIDRRNRLWVQIKTANPTYTQFEIEARLEQFGA* |
| Ga0134122_103228982 | 3300010400 | Terrestrial Soil | VNIESEGSMINQMRDHHMKILQAYIDRRNRLWAQIKAAYPTYSQPEIEARLEQFGA* |
| Ga0137383_111686061 | 3300012199 | Vadose Zone Soil | MINQMRDHQMKILQAYIDRRNRLWTQIKAAYPTYTQPEIEARLEQFGA* |
| Ga0137399_115761491 | 3300012203 | Vadose Zone Soil | MINQMRDHQMKILQAYIDRRNRLWVQIKAAYPTYTQPEIEARLEQFGV* |
| Ga0137380_115014521 | 3300012206 | Vadose Zone Soil | MINQMRDHQMKILQAYIDRRNRLWAQIKSAYPTYTQPEIEARLEQFGA* |
| Ga0137378_116574051 | 3300012210 | Vadose Zone Soil | MINQRRDHQMKILQAYIDRRNRLWVQIKAAYPTYTQPEIEA |
| Ga0137387_111176492 | 3300012349 | Vadose Zone Soil | MINQMRDHQMKILQAYIDRRNRLWVQIKAAYPTYTQPEIEARLEQFGA* |
| Ga0137385_102222842 | 3300012359 | Vadose Zone Soil | MINQMRDHQMKILQAYIDRRNRLWAQINSAYPTYTPPEIEARLEQFGA* |
| Ga0137360_110340931 | 3300012361 | Vadose Zone Soil | MINQMRDHQMKILQAYIDRRNRLWTQIKAAYPTYTQPEIEARLEQFGV* |
| Ga0137358_106702872 | 3300012582 | Vadose Zone Soil | MINQMRDHQMKILQAYIDRRNRLWAQIKAAYPTYTQPEIEARLEQFGV* |
| Ga0137394_100274023 | 3300012922 | Vadose Zone Soil | MINQMRDHQMKILQAYVDRRNRLWAQIKAAYPTYTQPEIEARLEQFGA* |
| Ga0137413_111616221 | 3300012924 | Vadose Zone Soil | MINQMRNHQLKILQAYIDRRNRLWAQIKAACPTYTQPEIEARLEQFGA* |
| Ga0137413_116515611 | 3300012924 | Vadose Zone Soil | SNARARVSIELEGSMINQMRDHQMKILQAYIDRRNRLWAQIKAACPTYTQPEIEARLEQFGV* |
| Ga0137407_108283311 | 3300012930 | Vadose Zone Soil | MINQMRYKQMKILQAYIERRNRLWVQIKTANPTYTQFDIEARLEQFGA* |
| Ga0137407_114619631 | 3300012930 | Vadose Zone Soil | RSNGRARLNIELEGSMINQMRDKQLKILQAYIERRNRLWVQIKTANPTYTQFDIEARLEQFGV* |
| Ga0126369_132508001 | 3300012971 | Tropical Forest Soil | QMRDQQMKILQAYIDRRNRLWAQIKTAYPSYTQPEIEARLEQFGA* |
| Ga0164305_120790862 | 3300012989 | Soil | GFHFDSFVSNARARVNIESEGSMINQMRDHHMKILQAYIDRRNRLWAQIKAAYPTYSQPEIEARLEQFGA* |
| Ga0157378_111847491 | 3300013297 | Miscanthus Rhizosphere | HHMKILQAYIDRRNRLWAQIKAAYPTYSQPEIEARLEQFGA* |
| Ga0157376_100761462 | 3300014969 | Miscanthus Rhizosphere | VSIELEGSMINQMRDHHMKILQAYIDRRNRLWAQIKAAYPTYSQPEIEARLEQFGA* |
| Ga0137418_103143442 | 3300015241 | Vadose Zone Soil | VSIELEGSMINQMRDHQMKILQAYIDRRNRLWTQIKAAYPTYTQPEIEARLEQFGA* |
| Ga0137403_100132545 | 3300015264 | Vadose Zone Soil | MINQMRDHQMKILQAYIDRRNRLWAQIKAAYPTYTKPEIEARLEQFGA* |
| Ga0132258_116210151 | 3300015371 | Arabidopsis Rhizosphere | MVTQVQDSKQSKTLQAYIARRDHLWVRVKADHPTYSHAQIEARLEQFGA* |
| Ga0187785_107122341 | 3300017947 | Tropical Peatland | MINQMRDHQTKILQAYIDRRNRLWAQIKAAHPGFTQPEIEARLEQFGA |
| Ga0184608_100161122 | 3300018028 | Groundwater Sediment | MINQMRNHQLKNLQAYIDRRNRLWAQIKAAFPTYTQPEIEARLEQFGA |
| Ga0184617_10809351 | 3300018066 | Groundwater Sediment | MINQMRNHQLKNLQAYIDRRNRLWAQVRAAYPNYTQPEIEARLEQFGA |
| Ga0184609_103304792 | 3300018076 | Groundwater Sediment | MRLVRLSIELEGSMINQMRNHQLKILQAYIDRRNRLWAQIKAAFPTYTQPEIEARLEQFG |
| Ga0066667_107054512 | 3300018433 | Grasslands Soil | MINQMRDHQMKILQAYIDRRNRLWAQIKSTYPTYTQTEIEARLEQFGA |
| Ga0066662_116874081 | 3300018468 | Grasslands Soil | MINQMRDHQMKILQAYVDRRNRLWAQIKAAYPTYTQREIEARLEQFGA |
| Ga0179594_100894691 | 3300020170 | Vadose Zone Soil | MINQMRNHQMKILQAYIDRRNRLWAQIKAAHPSYTKPEIEARLEQFGV |
| Ga0179594_101718791 | 3300020170 | Vadose Zone Soil | MINQMRDHQMKILQAYVDRRNRLWAQIKAAYPTYTQPEIEARLEQFGA |
| Ga0210378_102940711 | 3300021073 | Groundwater Sediment | MINQMRELKHSKILQAYIDRRTRLWVQIRVANPTYTQPDIEARLEQLGA |
| Ga0210381_100695331 | 3300021078 | Groundwater Sediment | MINQMRNHQLKILQAYIDRRNRLWAQIKAAYPTYTQPEIEARLEQFGA |
| Ga0222622_112212512 | 3300022756 | Groundwater Sediment | FVSNACARVNIELEGSMINQMRDHQMKILQAYIERRNRLWAHIKAAYPTYTQPEIEARLEQFGV |
| Ga0207641_121944762 | 3300026088 | Switchgrass Rhizosphere | ETFVSNARARVNIESEGSMINQMRDHHMKILQAYIDRRNRLWAQIKAAYPTYSQPEIEARLEQFGA |
| Ga0209886_10244492 | 3300027273 | Groundwater Sand | MINQVREPRQSKTLQAYIDRRNRLWTQVKADNPAYTQAEIEARLEQFGA |
| Ga0209213_10398892 | 3300027383 | Forest Soil | MINQMRDHQMKILQAYIDRRNRLSAQIKAAYPTYTQPEIEARLEQFGV |
| Ga0209466_10135971 | 3300027646 | Tropical Forest Soil | MINQMRDKQLKILQAYIERRNRLWEQIKVANPTYTQIEVEARLEQFGA |
| Ga0209466_10877331 | 3300027646 | Tropical Forest Soil | NTRVRLSIELEGSMINQMRDKQLKILQAYIDRRNRLWVQIKTANPTYTQFEIEARLEQFG |
| Ga0209682_100079101 | 3300027716 | Wetland Sediment | MINQMREFKHSKILQAYIDRRNRLWAQIRVAHPTYTPLDIEARLEQLGA |
| Ga0209465_104254982 | 3300027874 | Tropical Forest Soil | MINQMHDKQLKILQAYIDRRNRLWAQIKAANPTYTQLDVEARLEQFGA |
| Ga0209488_100057983 | 3300027903 | Vadose Zone Soil | MINQMRDHQMKILQAYIDRRNRLWAQIKAACPTYTQPEIEARLEQFGV |
| Ga0207428_100618212 | 3300027907 | Populus Rhizosphere | MINQMRDHQMKILQAYIDRRNRLWTQIKAAHPTFTQPEIEARLEQFGA |
| Ga0137415_101385382 | 3300028536 | Vadose Zone Soil | MINQMRDHQMKILQAYIDRRNRLWTQIKAAYPTYTQPEIEARLEQFGA |
| Ga0307499_100532572 | 3300031184 | Soil | MINQMRDHQMKILQAYIERRNRLWAHIKAAYPTYTQPEIEARLEQFGV |
| Ga0307499_101284401 | 3300031184 | Soil | DFISNAGVRLSIELEGSMINQIRDRQMKILQAYVDRRNRLWAQIKATHPSYTQREIEARLEQFGA |
| Ga0307500_100103131 | 3300031198 | Soil | MINQIRDRQMKILQAYVDRRNRLWAQIKATHPSYTQREIEARLEQFGA |
| Ga0307500_100436412 | 3300031198 | Soil | MINQMRDHQMKILQVYIDRRNRLWAQIKAAYPTYSQPEIEARLEQFGA |
| Ga0307468_1001120382 | 3300031740 | Hardwood Forest Soil | MINQMRDKQLKILQAYIERRNRLWVQIKIANPTYTQFDIEARLEQFGA |
| Ga0307468_1009317411 | 3300031740 | Hardwood Forest Soil | MINQMRDHQMKILQAYIDRRNRLWMQIKAAYPTYTQREIEARLEQFGA |
| ⦗Top⦘ |