


| Basic Information | |
|---|---|
| Family ID | F096061 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTREEFFEWLNTCPTHKWEITHDEYGHVVVSFPTDEEE |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 80.95 % |
| % of genes near scaffold ends (potentially truncated) | 30.48 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.048 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (21.905 % of family members) |
| Environment Ontology (ENVO) | Unclassified (80.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.476 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.15% β-sheet: 16.67% Coil/Unstructured: 68.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF13203 | DUF2201_N | 3.81 |
| PF00589 | Phage_integrase | 2.86 |
| PF07275 | ArdA | 1.90 |
| PF07486 | Hydrolase_2 | 1.90 |
| PF03237 | Terminase_6N | 1.90 |
| PF03592 | Terminase_2 | 1.90 |
| PF11753 | DUF3310 | 0.95 |
| PF02511 | Thy1 | 0.95 |
| PF01612 | DNA_pol_A_exo1 | 0.95 |
| PF06094 | GGACT | 0.95 |
| PF02794 | HlyC | 0.95 |
| PF13392 | HNH_3 | 0.95 |
| PF09723 | Zn-ribbon_8 | 0.95 |
| PF04316 | FlgM | 0.95 |
| PF06048 | DUF927 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG2747 | Negative regulator of flagellin synthesis (anti-sigma28 factor) | Transcription [K] | 2.86 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 1.90 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 1.90 |
| COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 1.90 |
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.95 |
| COG2994 | ACP:hemolysin acyltransferase (hemolysin-activating protein) | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
| COG5519 | Predicted ATPase domain of Cch-like helicases, DUF927 family | General function prediction only [R] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.05 % |
| All Organisms | root | All Organisms | 40.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10004067 | Not Available | 8233 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10016504 | All Organisms → Viruses → Predicted Viral | 3678 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10088167 | Not Available | 1181 | Open in IMG/M |
| 3300001346|JGI20151J14362_10108991 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 928 | Open in IMG/M |
| 3300001355|JGI20158J14315_10007135 | Not Available | 6741 | Open in IMG/M |
| 3300001450|JGI24006J15134_10009324 | Not Available | 4891 | Open in IMG/M |
| 3300001450|JGI24006J15134_10077197 | All Organisms → Viruses → Predicted Viral | 1257 | Open in IMG/M |
| 3300001450|JGI24006J15134_10147436 | Not Available | 776 | Open in IMG/M |
| 3300001450|JGI24006J15134_10155104 | Not Available | 745 | Open in IMG/M |
| 3300001450|JGI24006J15134_10196755 | Not Available | 618 | Open in IMG/M |
| 3300001450|JGI24006J15134_10253283 | Not Available | 504 | Open in IMG/M |
| 3300001460|JGI24003J15210_10082904 | Not Available | 964 | Open in IMG/M |
| 3300001472|JGI24004J15324_10111109 | Not Available | 687 | Open in IMG/M |
| 3300001472|JGI24004J15324_10112040 | Not Available | 682 | Open in IMG/M |
| 3300001853|JGI24524J20080_1013890 | Not Available | 907 | Open in IMG/M |
| 3300003580|JGI26260J51721_1058680 | Not Available | 584 | Open in IMG/M |
| 3300003617|JGI26082J51739_10021330 | All Organisms → Viruses → Predicted Viral | 2700 | Open in IMG/M |
| 3300003621|JGI26083J51738_10094886 | Not Available | 639 | Open in IMG/M |
| 3300004097|Ga0055584_101467486 | Not Available | 708 | Open in IMG/M |
| 3300004279|Ga0066605_10264296 | Not Available | 641 | Open in IMG/M |
| 3300004448|Ga0065861_1055755 | All Organisms → Viruses → Predicted Viral | 2751 | Open in IMG/M |
| 3300004448|Ga0065861_1089101 | Not Available | 650 | Open in IMG/M |
| 3300006164|Ga0075441_10134994 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 935 | Open in IMG/M |
| 3300006484|Ga0070744_10075539 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300006750|Ga0098058_1163358 | Not Available | 586 | Open in IMG/M |
| 3300006752|Ga0098048_1088331 | Not Available | 943 | Open in IMG/M |
| 3300006810|Ga0070754_10236580 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 838 | Open in IMG/M |
| 3300006868|Ga0075481_10253171 | Not Available | 620 | Open in IMG/M |
| 3300006922|Ga0098045_1108857 | Not Available | 650 | Open in IMG/M |
| 3300007345|Ga0070752_1000672 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 26781 | Open in IMG/M |
| 3300007539|Ga0099849_1122245 | All Organisms → Viruses → Predicted Viral | 1023 | Open in IMG/M |
| 3300007539|Ga0099849_1346528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCGB20 | 529 | Open in IMG/M |
| 3300007554|Ga0102820_1128727 | Not Available | 609 | Open in IMG/M |
| 3300007640|Ga0070751_1259574 | Not Available | 657 | Open in IMG/M |
| 3300007640|Ga0070751_1332711 | Not Available | 560 | Open in IMG/M |
| 3300007647|Ga0102855_1037053 | All Organisms → Viruses → Predicted Viral | 1338 | Open in IMG/M |
| 3300007647|Ga0102855_1077064 | Not Available | 897 | Open in IMG/M |
| 3300007647|Ga0102855_1125915 | Not Available | 685 | Open in IMG/M |
| 3300009024|Ga0102811_1099188 | Not Available | 1090 | Open in IMG/M |
| 3300009071|Ga0115566_10015367 | Not Available | 5699 | Open in IMG/M |
| 3300009071|Ga0115566_10155447 | All Organisms → Viruses → Predicted Viral | 1424 | Open in IMG/M |
| 3300009074|Ga0115549_1194123 | Not Available | 649 | Open in IMG/M |
| 3300009079|Ga0102814_10511702 | Not Available | 655 | Open in IMG/M |
| 3300009086|Ga0102812_10346286 | Not Available | 808 | Open in IMG/M |
| 3300009149|Ga0114918_10180647 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300009428|Ga0114915_1160910 | Not Available | 633 | Open in IMG/M |
| 3300009472|Ga0115554_1210346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 786 | Open in IMG/M |
| 3300009507|Ga0115572_10080310 | All Organisms → Viruses → Predicted Viral | 1988 | Open in IMG/M |
| 3300009507|Ga0115572_10552627 | Not Available | 636 | Open in IMG/M |
| 3300010300|Ga0129351_1293094 | Not Available | 616 | Open in IMG/M |
| 3300013010|Ga0129327_10015168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4143 | Open in IMG/M |
| 3300017710|Ga0181403_1082434 | Not Available | 669 | Open in IMG/M |
| 3300017714|Ga0181412_1015848 | All Organisms → Viruses → Predicted Viral | 2174 | Open in IMG/M |
| 3300017728|Ga0181419_1002942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5527 | Open in IMG/M |
| 3300017728|Ga0181419_1024443 | All Organisms → Viruses → Predicted Viral | 1678 | Open in IMG/M |
| 3300017743|Ga0181402_1099693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Boseongicola → Boseongicola aestuarii | 751 | Open in IMG/M |
| 3300017753|Ga0181407_1030106 | Not Available | 1467 | Open in IMG/M |
| 3300017760|Ga0181408_1130102 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300017782|Ga0181380_1038606 | All Organisms → Viruses → Predicted Viral | 1734 | Open in IMG/M |
| 3300017824|Ga0181552_10008468 | Not Available | 6855 | Open in IMG/M |
| 3300017951|Ga0181577_10000582 | Not Available | 29831 | Open in IMG/M |
| 3300017956|Ga0181580_10898180 | Not Available | 553 | Open in IMG/M |
| 3300020176|Ga0181556_1300215 | Not Available | 548 | Open in IMG/M |
| 3300020438|Ga0211576_10250157 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300021373|Ga0213865_10048766 | All Organisms → Viruses → Predicted Viral | 2347 | Open in IMG/M |
| 3300022061|Ga0212023_1004835 | Not Available | 1588 | Open in IMG/M |
| 3300022187|Ga0196899_1186722 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 556 | Open in IMG/M |
| 3300022187|Ga0196899_1208726 | Not Available | 514 | Open in IMG/M |
| 3300022900|Ga0255771_1182028 | Not Available | 810 | Open in IMG/M |
| 3300022934|Ga0255781_10413818 | Not Available | 568 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10089519 | All Organisms → Viruses → Predicted Viral | 1767 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10481189 | Not Available | 560 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10532932 | Not Available | 514 | Open in IMG/M |
| 3300024348|Ga0244776_10371497 | Not Available | 956 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10061076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. | 1881 | Open in IMG/M |
| 3300025071|Ga0207896_1000552 | All Organisms → cellular organisms → Bacteria | 7642 | Open in IMG/M |
| 3300025086|Ga0208157_1105845 | Not Available | 670 | Open in IMG/M |
| 3300025120|Ga0209535_1019833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. | 3436 | Open in IMG/M |
| 3300025120|Ga0209535_1181818 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300025137|Ga0209336_10102497 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 806 | Open in IMG/M |
| 3300025138|Ga0209634_1151665 | Not Available | 944 | Open in IMG/M |
| 3300025168|Ga0209337_1115373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. | 1222 | Open in IMG/M |
| 3300025168|Ga0209337_1330192 | Not Available | 534 | Open in IMG/M |
| 3300025168|Ga0209337_1340583 | Not Available | 519 | Open in IMG/M |
| 3300025610|Ga0208149_1087878 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300025617|Ga0209138_1105582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 814 | Open in IMG/M |
| 3300025626|Ga0209716_1053069 | All Organisms → Viruses → Predicted Viral | 1325 | Open in IMG/M |
| 3300025668|Ga0209251_1005842 | All Organisms → cellular organisms → Bacteria | 7112 | Open in IMG/M |
| 3300025668|Ga0209251_1114124 | Not Available | 750 | Open in IMG/M |
| 3300025674|Ga0208162_1063164 | Not Available | 1195 | Open in IMG/M |
| 3300025674|Ga0208162_1152102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 633 | Open in IMG/M |
| 3300025695|Ga0209653_1049014 | Not Available | 1624 | Open in IMG/M |
| 3300025704|Ga0209602_1045546 | All Organisms → Viruses → Predicted Viral | 1856 | Open in IMG/M |
| 3300025869|Ga0209308_10003934 | Not Available | 11999 | Open in IMG/M |
| 3300025869|Ga0209308_10009415 | Not Available | 6825 | Open in IMG/M |
| 3300025870|Ga0209666_1134190 | Not Available | 1147 | Open in IMG/M |
| 3300025880|Ga0209534_10322670 | Not Available | 700 | Open in IMG/M |
| 3300027668|Ga0209482_1189471 | Not Available | 577 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10076262 | Not Available | 1444 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10642705 | Not Available | 518 | Open in IMG/M |
| 3300028287|Ga0257126_1011083 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4769 | Open in IMG/M |
| 3300029787|Ga0183757_1047037 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300031143|Ga0308025_1161156 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 789 | Open in IMG/M |
| 3300031621|Ga0302114_10035698 | All Organisms → Viruses → Predicted Viral | 2539 | Open in IMG/M |
| 3300032373|Ga0316204_11178541 | Not Available | 535 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 21.90% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.38% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 9.52% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 8.57% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 7.62% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 7.62% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.71% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.76% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.76% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.81% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.86% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.90% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.90% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.95% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.95% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.95% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.95% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.95% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.95% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001853 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300003617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA | Environmental | Open in IMG/M |
| 3300003621 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022900 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025668 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_1000406717 | 3300000116 | Marine | MTREEFFEWLNTCPTHKWEITHDEYGHVVVSFPTDEEE* |
| DelMOSpr2010_100165045 | 3300000116 | Marine | MTRKEFFEWLITCPSHKWEINDDEYDYVVVGFPTDRDEEVNKES* |
| DelMOWin2010_100881674 | 3300000117 | Marine | MTRKEFFEWLETCPTHKFNITFDEYDFVTVCFPTIEETDELEGEI* |
| JGI20151J14362_101089911 | 3300001346 | Pelagic Marine | MTREELYEWLNTCPTHKWEITTDEFSFVAISFPTQEE |
| JGI20158J14315_100071351 | 3300001355 | Pelagic Marine | MTREELYEWLNTCPTHKWEITTDEFSFVAISFPTQEEENCGD* |
| JGI24006J15134_100093242 | 3300001450 | Marine | MTREEFFEWLNTCPTHKWETTADEYGFLAVSFKIEETEEVIK* |
| JGI24006J15134_100771972 | 3300001450 | Marine | MTREEFFNWLNDCPTHKWEITCDEYGYVIVSFPTIEKGEE* |
| JGI24006J15134_101474363 | 3300001450 | Marine | MDRKEFFEWLATCPTHKWEPIFDERDFVAVSFPVQEVEKD* |
| JGI24006J15134_101551041 | 3300001450 | Marine | FEWLETCPTHKWNIAADEVDHVVITFPTEEEEEE* |
| JGI24006J15134_101967552 | 3300001450 | Marine | MSETLGERLMDRKEFFEWLETCPTHKWEPTADEYGFVAVSFPIQEEEEE* |
| JGI24006J15134_102532833 | 3300001450 | Marine | MDRKEFFEWLSTCPTHKWEPIFDEHSFVAVSFPVKEDEESD* |
| JGI24003J15210_100829043 | 3300001460 | Marine | MDRKEFFEWLTTCPTHKWEPIFDEHSFVAVSFPVKEDEESD* |
| JGI24004J15324_101111093 | 3300001472 | Marine | MDRKEFFEWLTTCPTHKWEPIFDEHSFVAVSFPVKEDEEMKDS* |
| JGI24004J15324_101120401 | 3300001472 | Marine | MDRKEFFEWLETCPTHKWEPTADEYGFVAVSFPIQEEEEE* |
| JGI24524J20080_10138904 | 3300001853 | Marine | LCRGVRLMDRKEFFEWLTTCPTHKWEPIFDEHSFVAVSFPVKEDEESD* |
| JGI26260J51721_10586801 | 3300003580 | Marine | MTRKEFFEWLETCPTHKFNITFDEYEFVTVCFPTIEETDELIEES* |
| JGI26082J51739_100213302 | 3300003617 | Marine | MTREEFFEWLNTCPTHKWETTADEYGYVVVSFPTYEEEETE* |
| JGI26083J51738_100948861 | 3300003621 | Marine | MTRKEFFEWLETCPTHKFNITFDEYDFVTVCFPTIEEADESEGEI* |
| Ga0055584_1014674863 | 3300004097 | Pelagic Marine | MTRTEFFEWLNKCPTHKWEVTADEYGYVVVSFLTDEEEEEAA* |
| Ga0066605_102642962 | 3300004279 | Marine | PVPSNHSGVGVMTRKEFFEWLETCPTHKFNITFDEYEFVTVCFPTIEETDELIEES* |
| Ga0065861_10557553 | 3300004448 | Marine | MTREEFFEWLDTCPTHKWEITHEECGRWTKRSCVGSNGHVVVSFPTDEEEENDNDHYQP* |
| Ga0065861_10891012 | 3300004448 | Marine | MDRKEFFEWLETCPTHKWEITADEYGYVVVSFPNNEEEEEAA* |
| Ga0075441_101349942 | 3300006164 | Marine | MDRKEFFEWLGTCPTHKWDITFDHDGHVVVSFPIEEEEEANNAD* |
| Ga0070744_100755394 | 3300006484 | Estuarine | MTREEFYEWLNTCPTHKWEITADEFSFVAVSFPTKEEEISDVHT* |
| Ga0098058_11633581 | 3300006750 | Marine | MDRESFFEWLETCPTHKFNITFDEYEFVTICFPIEPDTDQDAQDS* |
| Ga0098048_10883311 | 3300006752 | Marine | MNRESFFEWLETCPTHKFNITFDEYEFVTICFPIEPDTDQDAQDS* |
| Ga0070754_102365804 | 3300006810 | Aqueous | MTREEFFEWLETSPTHKWEITHEEYGHVVVSFPTDEEEEEA* |
| Ga0075481_102531711 | 3300006868 | Aqueous | LAPRFYMTREEFFEWLDTCPTHKWEITHEEYGHVVVSFPN |
| Ga0098045_11088571 | 3300006922 | Marine | MDRESFFEWLETCPTHKFNITFDEYEFVTICFPIEPDTDQDAKDS* |
| Ga0070752_10006721 | 3300007345 | Aqueous | REEFFEWLETCPTHKWEITHEEYGHVVVSFPTDEEAEESE* |
| Ga0099849_11222453 | 3300007539 | Aqueous | MTMTRKEFFEWLETCPSHKWEVTADEYEFVVVSFPTTEEEETEDA* |
| Ga0099849_13465282 | 3300007539 | Aqueous | MSREEFFEWLDTCPTHKWEITHEEYGHVVVSFPNDE |
| Ga0102820_11287271 | 3300007554 | Estuarine | MTRTEFFEWLNKCPTHKWEITADEYGFVVVSFPTDEEEEEAA* |
| Ga0070751_12595741 | 3300007640 | Aqueous | MTRAEFFEWLDTCPTHKWEVTHEEYGHVVISFPNEEE |
| Ga0070751_13327113 | 3300007640 | Aqueous | MTREEFFEWLDTCPTHKWEITHEEYGHVVVSFPNDEE |
| Ga0102855_10370535 | 3300007647 | Estuarine | MTREEFYEWLNTCPTHKWEITADEFSFVAVSFPTKEEEISD |
| Ga0102855_10770644 | 3300007647 | Estuarine | TREEFYEWLNTCPTHKWEITADEFSFVAVSFPTKEEEISDVHT* |
| Ga0102855_11259153 | 3300007647 | Estuarine | TREEFYEWLNTCPTHKWEITADEFSFVAVSFPTKEEEISDAHT* |
| Ga0102811_10991881 | 3300009024 | Estuarine | MTRIEFFEWLNNCPTHKWEVTADEYGYVVVSFLTDEEEE |
| Ga0115566_100153676 | 3300009071 | Pelagic Marine | MTREELYEWLNTCPTHKWEITTDEFSFVAISFPTQEEDNCGDD* |
| Ga0115566_101554473 | 3300009071 | Pelagic Marine | MDRKEFFEWLETCPTHKWEITHEEYGHVVVSFPTDEEAEESE* |
| Ga0115549_11941233 | 3300009074 | Pelagic Marine | MDRKEFFEWLNTCPTHKHNITFDEFDFVTVCFPIEED |
| Ga0102814_105117021 | 3300009079 | Estuarine | EFFEWLNNCPTHKWEVTADEYGYVVVSFLTDEEEEEAA* |
| Ga0102812_103462861 | 3300009086 | Estuarine | MTRIEFFEWLNNCPTHKWEVTADEYGYVVVSFLTDEEEEEAA |
| Ga0114918_101806472 | 3300009149 | Deep Subsurface | MTRKELFEWLATCPTHKWEITAAADGYVVVSFPTQEEEEEGE* |
| Ga0114915_11609102 | 3300009428 | Deep Ocean | MTRKEFFEWLETCPTHKWDTTFDENGHVVVSFPTHEEEGE* |
| Ga0115554_12103461 | 3300009472 | Pelagic Marine | NLRLRGLTMTREELYEWLNTCPTHKWEITTDEFSFVAISFPTQEEDNCGDD* |
| Ga0115572_100803106 | 3300009507 | Pelagic Marine | MTREEFFEWLDKCPTHKWEITHEEYGHVVVSFPTDEEKYKEDKA* |
| Ga0115572_105526272 | 3300009507 | Pelagic Marine | MDRKEFFEWLSTCPTHKWQPIFDEHSFVAVSFPVKEDEESD* |
| Ga0129351_12930941 | 3300010300 | Freshwater To Marine Saline Gradient | MTREEFFEWLDTCPTNRWEITHEEYGHVVISFPNDEN |
| Ga0129327_100151685 | 3300013010 | Freshwater To Marine Saline Gradient | MENIMDRKEFFECLETCPTHKWNIAADEVDHVVITFPTEEEEEE* |
| Ga0181403_10824342 | 3300017710 | Seawater | MTREEFFEWLNTCPTHKWDITADEYGFVSVSFPTIEEEEENA |
| Ga0181412_10158485 | 3300017714 | Seawater | VNTARIEFFEWLNKCPTHKWEITADEYGYVVVSFPIDEEEESV |
| Ga0181419_10029427 | 3300017728 | Seawater | MSDESVNTARIEFFEWLNKCPTHKWEITADEYGYVVVSFPIDEEEESV |
| Ga0181419_10244434 | 3300017728 | Seawater | MGDESVNTARIEFFEWLNKCPTHKWEITADEYGYVVVSFPIDEEEESV |
| Ga0181402_10996932 | 3300017743 | Seawater | MTREEFFEWLNTCPTHKWDVTADEYGFVSVSFPTIEEEEENS |
| Ga0181407_10301062 | 3300017753 | Seawater | MTRKEFFEWLETCPTHKFNITFDEYEFVTVCFPTIEEADELDSV |
| Ga0181408_11301022 | 3300017760 | Seawater | MTREEFFEWLNTCPTHKWDITADEYGFVSVSFPTIEEEEENS |
| Ga0181380_10386061 | 3300017782 | Seawater | MDRESFFEWLETCPTHKFNITFDEYEFVTICFPIEPDTDKDSSDS |
| Ga0181552_1000846815 | 3300017824 | Salt Marsh | MTREEFFEWLNTCPTHKWEITHDEYGHVVVSFPTDEEE |
| Ga0181577_100005821 | 3300017951 | Salt Marsh | EEFFEWLETCPTHKHNITFDEFDFVTVCFPIEEEEEESAA |
| Ga0181580_108981802 | 3300017956 | Salt Marsh | MTREEFFEWLETCPTHKHNITFDEFDFVTVCFPIEE |
| Ga0181556_13002151 | 3300020176 | Salt Marsh | SYLRGLCKRGDSMTREEFFEWLNTCPTHKWEITHDEYGHVVVSFPTDEEE |
| Ga0211576_102501574 | 3300020438 | Marine | MTREEFYEWLNTCPTHKWEITADEFSFVAVSFPTKEEEISDVHT |
| Ga0213865_100487664 | 3300021373 | Seawater | MDRKEFFEWLETCPTHKWEITHEEYGHVVVSFPTDEEAEESE |
| Ga0212023_10048355 | 3300022061 | Aqueous | MTRKEFFEWLETCPTHKFNITFDEYDFVTVCFPTIEETDELEGEI |
| Ga0196899_11867222 | 3300022187 | Aqueous | MTREEFFEWLETCPTHKWEITHEEYGHVVVSFPTDEEEE |
| Ga0196899_12087262 | 3300022187 | Aqueous | GFFEWLETCPTHKWEITHEEYGHVVVSFPNDEEDEEELLSKELAA |
| Ga0255771_11820281 | 3300022900 | Salt Marsh | MTREEFFEWLNTCPTHKWETTTDEYGFVAVSFKIEETEEESE |
| Ga0255781_104138183 | 3300022934 | Salt Marsh | EFYEWLNTCPTHKWEITYDDFEFVSVSFPTEETEEGEDDAL |
| (restricted) Ga0233432_100895192 | 3300023109 | Seawater | MTRKEFFEWLETCPSHKWEVTADEYEFVVVSFPTTEEEENDNVSNR |
| (restricted) Ga0233412_104811892 | 3300023210 | Seawater | MTRKEFFEWLETCPTHKFNITFDEYEFVTVCFPTIEETDELIEES |
| (restricted) Ga0255039_105329322 | 3300024062 | Seawater | MTRTEFFEWLNKCPTHKWEITADEYGFVVVSFPTDEEEEEAA |
| Ga0244776_103714971 | 3300024348 | Estuarine | MTREEFYEWLNTCPTHKWEITADEFSFVAVSFPTKEEEISDAHT |
| (restricted) Ga0255048_100610764 | 3300024518 | Seawater | MTMTRKEFFEWLDECPTHKWKITHEEYGHVVVSFPTTEEEETEDA |
| Ga0207896_10005529 | 3300025071 | Marine | MTREEFFEWLNTCPTHKWETTADEYGFLAVSFKIEETEEVIK |
| Ga0208157_11058452 | 3300025086 | Marine | MTREEFFEWLNTCPTHKWDVTADEYGFVSVSFPTIEEEEKENS |
| Ga0209535_10198335 | 3300025120 | Marine | MDRKEFFEWLATCPTHKWEPIFDERDFVAVSFPVQEVEKD |
| Ga0209535_11818182 | 3300025120 | Marine | MDRKEFFEWLETCPTHKWEPTADEYGFVAVSFPIQEEEEE |
| Ga0209336_101024972 | 3300025137 | Marine | MDRKEFFEWLETCPTHKWDITADEYGFTVVSFPNNEEEEEEAA |
| Ga0209634_11516654 | 3300025138 | Marine | MDRKEFFEWLSTCPTHKWEPIFDEHSFVAVSFPVKEDEESD |
| Ga0209337_11153733 | 3300025168 | Marine | MSETLGERLMDRKEFFEWLETCPTHKWEPTADEYGFVAVSFPIQEEEEE |
| Ga0209337_13301921 | 3300025168 | Marine | KEFFEWLETCPTHKWEPTADEYGFVAVSFPIQEEEEE |
| Ga0209337_13405832 | 3300025168 | Marine | LMDRKEFFEWLTTCPTHKWEPIFDEHSFVAVSFPVKEDEESD |
| Ga0208149_10878782 | 3300025610 | Aqueous | MTREEFFEWLDKCPTHKWEITHEEYGHVVVSFPTDEEEENDNDHYQP |
| Ga0209138_11055823 | 3300025617 | Marine | MTREEFFEWLNTCPTHKWETTADEYGYVVVSFPTYEEEETE |
| Ga0209716_10530695 | 3300025626 | Pelagic Marine | MTREELYEWLNTCPTHKWEITTDEFSFVAISFPTQEEDNCGDD |
| Ga0209251_10058425 | 3300025668 | Marine | MTRKEFFEWLETCPSHKWEVTADEYEFVVVSFPTTEEEE |
| Ga0209251_11141242 | 3300025668 | Marine | MTREEFFKWLETCPTHKFNITFDEYEFVTVCFPTI |
| Ga0208162_10631643 | 3300025674 | Aqueous | MTMTRKEFFEWLETCPSHKWEVTADEYEFVVVSFPTTEEEETEDA |
| Ga0208162_11521022 | 3300025674 | Aqueous | MSREEFFEWLDTCPTHKWEITHEEYGHVVVSFPNDEE |
| Ga0209653_10490144 | 3300025695 | Marine | MTRKEFFEWLETCPTHKFNITFDEYDFVTVCFPTIEEADESEGEI |
| Ga0209602_10455467 | 3300025704 | Pelagic Marine | MTREEFFEWLDKCPTHKWEITHEEYGHVVVSFPTDEEKYKEDVA |
| Ga0209308_100039341 | 3300025869 | Pelagic Marine | MTREELYEWLNTCPTHKWEITTDEFSFVAISFPTQEEENCGD |
| Ga0209308_100094151 | 3300025869 | Pelagic Marine | RGLTMTREELYEWLNTCPTHKWEITTDEFSFVAISFPTQEEDNCGDD |
| Ga0209666_11341904 | 3300025870 | Marine | MTRKEFFEWLEICPTHKWDITADEYGYTVVSFPTDEEE |
| Ga0209534_103226702 | 3300025880 | Pelagic Marine | MSRVEFFEWLESCPTHKWEVTYDEYGATSISFPHTEEEEE |
| Ga0209482_11894712 | 3300027668 | Marine | MDRKEFFEWLGTCPTHKWDITFDHDGHVVVSFPIEEEEEANNAD |
| (restricted) Ga0233415_100762622 | 3300027861 | Seawater | MTRKEFFEWLETCPTHKFNITFDEYDFVTVCFPTIEETDELIEES |
| (restricted) Ga0233415_106427052 | 3300027861 | Seawater | MTRAEFFEWLNKCPTHKWEITADEYGFVVVSFPTDEEEEEAE |
| Ga0257126_10110833 | 3300028287 | Marine | MTRKEFFEWLDECPTHKWKITHEEYGHVVVSFPTTEEEETEDA |
| Ga0183757_10470371 | 3300029787 | Marine | MMTREEFFKWLDTCPTHKWEITHYAYGPRRLTRKEYGHVVVSFPVKGEEE |
| Ga0308025_11611563 | 3300031143 | Marine | MTKKEFFEWIAETCPTHKWDISLNEDAFVVVSFPIEEEEEEE |
| Ga0302114_100356984 | 3300031621 | Marine | MTREEFYEWLNTCPDGTYKWEVTADEHGFVAVSFPTQEDEEESTQ |
| Ga0316204_111785412 | 3300032373 | Microbial Mat | MTREEFFEWLDKCPTHKWEITHEEYGHVVVSFPTD |
| ⦗Top⦘ |