


| Basic Information | |
|---|---|
| Family ID | F096059 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 40 residues |
| Representative Sequence | QRRASEAELAAARRAFEEDAGVKGLRERFGATVLPETVRPVK |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.43 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.381 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.524 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.524 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.57% β-sheet: 0.00% Coil/Unstructured: 61.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF02575 | YbaB_DNA_bd | 59.05 |
| PF13662 | Toprim_4 | 23.81 |
| PF02132 | RecR | 6.67 |
| PF03193 | RsgA_GTPase | 2.86 |
| PF00633 | HHH | 2.86 |
| PF04366 | Ysc84 | 1.90 |
| PF00929 | RNase_T | 0.95 |
| PF02896 | PEP-utilizers_C | 0.95 |
| PF13011 | LZ_Tnp_IS481 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0718 | DNA-binding nucleoid-associated protein YbaB/EfbC | Transcription [K] | 59.05 |
| COG0353 | Recombinational DNA repair protein RecR | Replication, recombination and repair [L] | 6.67 |
| COG1162 | Ribosome biogenesis GTPase RsgA | Translation, ribosomal structure and biogenesis [J] | 2.86 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 1.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.38 % |
| Unclassified | root | N/A | 27.62 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886006|SwRhRL3b_contig_2730924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 937 | Open in IMG/M |
| 3300005163|Ga0066823_10109754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 575 | Open in IMG/M |
| 3300005363|Ga0008090_15759491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 689 | Open in IMG/M |
| 3300005435|Ga0070714_101431679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae | 675 | Open in IMG/M |
| 3300005541|Ga0070733_10540871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 780 | Open in IMG/M |
| 3300005548|Ga0070665_100727948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1005 | Open in IMG/M |
| 3300006034|Ga0066656_10206938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1251 | Open in IMG/M |
| 3300006164|Ga0075441_10143212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 903 | Open in IMG/M |
| 3300006354|Ga0075021_10333736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 944 | Open in IMG/M |
| 3300006806|Ga0079220_10532753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 813 | Open in IMG/M |
| 3300010049|Ga0123356_10223220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1942 | Open in IMG/M |
| 3300010358|Ga0126370_11525617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
| 3300010359|Ga0126376_11829132 | Not Available | 646 | Open in IMG/M |
| 3300010360|Ga0126372_11167896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 792 | Open in IMG/M |
| 3300010371|Ga0134125_11131954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 856 | Open in IMG/M |
| 3300010373|Ga0134128_12416604 | Not Available | 579 | Open in IMG/M |
| 3300010375|Ga0105239_10917561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1005 | Open in IMG/M |
| 3300010387|Ga0136821_1251141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1396 | Open in IMG/M |
| 3300010866|Ga0126344_1327888 | Not Available | 523 | Open in IMG/M |
| 3300012361|Ga0137360_11763997 | Not Available | 525 | Open in IMG/M |
| 3300012469|Ga0150984_111632445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 834 | Open in IMG/M |
| 3300012930|Ga0137407_12048520 | Not Available | 546 | Open in IMG/M |
| 3300012982|Ga0168317_1030291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1482 | Open in IMG/M |
| 3300014325|Ga0163163_11530235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 728 | Open in IMG/M |
| 3300015373|Ga0132257_100182960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2473 | Open in IMG/M |
| 3300015374|Ga0132255_103315614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 686 | Open in IMG/M |
| 3300016341|Ga0182035_11749074 | Not Available | 562 | Open in IMG/M |
| 3300016357|Ga0182032_11829611 | Not Available | 531 | Open in IMG/M |
| 3300017947|Ga0187785_10505921 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300017961|Ga0187778_10346209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 967 | Open in IMG/M |
| 3300017970|Ga0187783_10772610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 693 | Open in IMG/M |
| 3300017974|Ga0187777_10550827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 809 | Open in IMG/M |
| 3300018001|Ga0187815_10326709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 651 | Open in IMG/M |
| 3300018090|Ga0187770_10055421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2866 | Open in IMG/M |
| 3300020070|Ga0206356_10508536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1108 | Open in IMG/M |
| 3300020150|Ga0187768_1127150 | Not Available | 585 | Open in IMG/M |
| 3300020581|Ga0210399_10538179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 969 | Open in IMG/M |
| 3300021180|Ga0210396_11329361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300021402|Ga0210385_10750446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 748 | Open in IMG/M |
| 3300021406|Ga0210386_10685105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 884 | Open in IMG/M |
| 3300021439|Ga0213879_10245009 | Not Available | 541 | Open in IMG/M |
| 3300021476|Ga0187846_10188677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 866 | Open in IMG/M |
| 3300022528|Ga0242669_1105140 | Not Available | 552 | Open in IMG/M |
| 3300025915|Ga0207693_10118284 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2081 | Open in IMG/M |
| 3300025924|Ga0207694_10451567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1073 | Open in IMG/M |
| 3300025929|Ga0207664_10366856 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300025941|Ga0207711_10084722 | Not Available | 2775 | Open in IMG/M |
| 3300026142|Ga0207698_10793090 | Not Available | 949 | Open in IMG/M |
| 3300026342|Ga0209057_1034705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2590 | Open in IMG/M |
| 3300027014|Ga0207815_1048778 | Not Available | 508 | Open in IMG/M |
| 3300027521|Ga0209524_1015216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1567 | Open in IMG/M |
| 3300027537|Ga0209419_1077055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 658 | Open in IMG/M |
| 3300027546|Ga0208984_1008495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1918 | Open in IMG/M |
| 3300027714|Ga0209815_1146557 | Not Available | 755 | Open in IMG/M |
| 3300027855|Ga0209693_10574581 | Not Available | 534 | Open in IMG/M |
| 3300027867|Ga0209167_10113531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1397 | Open in IMG/M |
| 3300027867|Ga0209167_10198745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1067 | Open in IMG/M |
| 3300027874|Ga0209465_10056148 | Not Available | 1891 | Open in IMG/M |
| 3300027882|Ga0209590_10814827 | Not Available | 592 | Open in IMG/M |
| 3300027889|Ga0209380_10389304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 818 | Open in IMG/M |
| 3300027908|Ga0209006_10989672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 670 | Open in IMG/M |
| 3300027910|Ga0209583_10726787 | Not Available | 520 | Open in IMG/M |
| 3300028906|Ga0308309_10110086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2149 | Open in IMG/M |
| 3300030618|Ga0311354_10145941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2588 | Open in IMG/M |
| 3300030737|Ga0302310_10121768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1593 | Open in IMG/M |
| 3300031184|Ga0307499_10219781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 593 | Open in IMG/M |
| 3300031507|Ga0307509_10550948 | Not Available | 831 | Open in IMG/M |
| 3300031544|Ga0318534_10069827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1987 | Open in IMG/M |
| 3300031564|Ga0318573_10098145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1500 | Open in IMG/M |
| 3300031573|Ga0310915_10704455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 713 | Open in IMG/M |
| 3300031708|Ga0310686_114285367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3944 | Open in IMG/M |
| 3300031713|Ga0318496_10431556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 728 | Open in IMG/M |
| 3300031723|Ga0318493_10144955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1225 | Open in IMG/M |
| 3300031744|Ga0306918_10499455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 952 | Open in IMG/M |
| 3300031770|Ga0318521_10503245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 728 | Open in IMG/M |
| 3300031782|Ga0318552_10204551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 999 | Open in IMG/M |
| 3300031794|Ga0318503_10083820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 1002 | Open in IMG/M |
| 3300031796|Ga0318576_10105221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1291 | Open in IMG/M |
| 3300031796|Ga0318576_10172716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1013 | Open in IMG/M |
| 3300031798|Ga0318523_10060875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1796 | Open in IMG/M |
| 3300031805|Ga0318497_10036349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2485 | Open in IMG/M |
| 3300031805|Ga0318497_10436009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 733 | Open in IMG/M |
| 3300031819|Ga0318568_10086637 | Not Available | 1861 | Open in IMG/M |
| 3300031880|Ga0318544_10430617 | Not Available | 513 | Open in IMG/M |
| 3300031894|Ga0318522_10054561 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300031910|Ga0306923_10272125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1937 | Open in IMG/M |
| 3300031941|Ga0310912_10261864 | Not Available | 1333 | Open in IMG/M |
| 3300031946|Ga0310910_10791286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 747 | Open in IMG/M |
| 3300031962|Ga0307479_10390605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1376 | Open in IMG/M |
| 3300031962|Ga0307479_11552945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300032009|Ga0318563_10420835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 723 | Open in IMG/M |
| 3300032009|Ga0318563_10787850 | Not Available | 509 | Open in IMG/M |
| 3300032010|Ga0318569_10205366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 913 | Open in IMG/M |
| 3300032025|Ga0318507_10476552 | Not Available | 543 | Open in IMG/M |
| 3300032055|Ga0318575_10210795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 977 | Open in IMG/M |
| 3300032065|Ga0318513_10364142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 705 | Open in IMG/M |
| 3300032068|Ga0318553_10550668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 604 | Open in IMG/M |
| 3300032180|Ga0307471_100484344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1382 | Open in IMG/M |
| 3300032180|Ga0307471_103840352 | Not Available | 531 | Open in IMG/M |
| 3300032261|Ga0306920_101763656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 875 | Open in IMG/M |
| 3300032892|Ga0335081_10787855 | Not Available | 1138 | Open in IMG/M |
| 3300032896|Ga0335075_10586196 | Not Available | 1108 | Open in IMG/M |
| 3300032955|Ga0335076_10392297 | Not Available | 1273 | Open in IMG/M |
| 3300033158|Ga0335077_10361760 | Not Available | 1569 | Open in IMG/M |
| 3300033289|Ga0310914_11292158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 632 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.52% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.86% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.90% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.90% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.95% |
| Sediment | Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.95% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.95% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.95% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.95% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.95% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.95% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.95% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010387 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M8 k-mer 51 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Host-Associated | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwRhRL3b_0930.00001570 | 2162886006 | Switchgrass Rhizosphere | SLEEVEAAKRALEADPGAQALRERFGATLLPDTVRPLKN |
| Ga0066823_101097542 | 3300005163 | Soil | AQRRASDSELAQARQAFEEDAGVKGLRERFGASVLPDSVRPVK* |
| Ga0008090_157594913 | 3300005363 | Tropical Rainforest Soil | ASEAELAAARRAFEEDPAVKGLRERFGATVLPETVRPVK* |
| Ga0070714_1014316791 | 3300005435 | Agricultural Soil | DQRVSQQELESARQAFDSDPGVQGLRERFGATLLPDTVRPVK* |
| Ga0070733_105408711 | 3300005541 | Surface Soil | DQRVSQEEAESARRAFESDPGVQGFRDRFGATMVPETIRPVK* |
| Ga0070665_1007279483 | 3300005548 | Switchgrass Rhizosphere | NLEELDSARQALESDPGVQALREKFGATLLPDSVRPLK* |
| Ga0066656_102069384 | 3300006034 | Soil | ARRVSEQELAAARRTFEAEPGVQGLRERFGATVLPDSVRPVK* |
| Ga0075441_101432123 | 3300006164 | Marine | AEQRASLEDLDSARRAFESDPGVQGLKERFGATLLPETVRPVK* |
| Ga0075021_103337361 | 3300006354 | Watersheds | AQRRAAEQELAQARRAFDTDPGVKGLRERFGATVLPETVRPVK* |
| Ga0079220_105327531 | 3300006806 | Agricultural Soil | PAQADQRVSQEEAEAARRAFESDPGVQGFRERFGATPVPETIRPVK* |
| Ga0123356_102232201 | 3300010049 | Termite Gut | SPAQAAQSASQLELEAARRAFDTDPGVQGLRDRFGATVLPESVRPVK* |
| Ga0126370_115256173 | 3300010358 | Tropical Forest Soil | ASEAELASARRAFEEDAGVKGLRDRFGATVLPDTVRPVK* |
| Ga0126376_118291321 | 3300010359 | Tropical Forest Soil | RRASEAELTAARHAFDEDAGVKGLRERFGAAVLPETVRPVK* |
| Ga0126372_111678963 | 3300010360 | Tropical Forest Soil | RATQQELSEARRAFDADPGVQGLRERFGATVLPDTVRPVK* |
| Ga0134125_111319543 | 3300010371 | Terrestrial Soil | ERSSLEEIESARRAFEADPGVQGLRERFGATLLPDTVRPLKS* |
| Ga0134128_124166043 | 3300010373 | Terrestrial Soil | SQQELEAARQAFESDPGVQGLRERFGATLLPDTVRPVK* |
| Ga0105239_109175611 | 3300010375 | Corn Rhizosphere | DSARRALEADPGVQGLRERFGATLLPDTVRPLKSQE* |
| Ga0136821_12511414 | 3300010387 | Sediment | QADAARQAFESDPGVRGFREQFAAEVMPETIRPQK* |
| Ga0126344_13278882 | 3300010866 | Boreal Forest Soil | LDVARQAFETDPGVKSLRERFGATLLPDTIRPVK* |
| Ga0137360_117639971 | 3300012361 | Vadose Zone Soil | QELDCARRAFEADPGVQGLRERFGATLLPETVRPVK* |
| Ga0150984_1116324453 | 3300012469 | Avena Fatua Rhizosphere | EKRAVVEELDSARQLLESDPAVRALRDTFGATLLPDSVRPLK* |
| Ga0137407_120485202 | 3300012930 | Vadose Zone Soil | AEQRASMEDLDAARRAFESDPGVQGLRERFGATLLPDTIRPVK* |
| Ga0168317_10302911 | 3300012982 | Weathered Mine Tailings | QRVSQAELEAARQAFESDPGAQGLRERFGATLLPDTVRPVK* |
| Ga0163163_115302353 | 3300014325 | Switchgrass Rhizosphere | VEELDSARQSLESDPAVRALRETFGATLLPDSVRPLK* |
| Ga0132257_1001829601 | 3300015373 | Arabidopsis Rhizosphere | RRAARRAFEEDAGVKGLRERFGATVLPDTVRPVK* |
| Ga0132255_1033156141 | 3300015374 | Arabidopsis Rhizosphere | PAQAQRSASEAELAAARRAFEDDAGVQSLRERFGATVLPDTVRPVK* |
| Ga0182035_117490741 | 3300016341 | Soil | PAQAQRRASEAELTAARRAFDEDAGVKGLRERFGAAVLPETVRPVK |
| Ga0182032_118296111 | 3300016357 | Soil | SEAELGAARRAFDEDAGVKGLRERFGAAVLPETVRPVK |
| Ga0187785_105059213 | 3300017947 | Tropical Peatland | QRRASEEELAAARRAFEADPGVQGLRERFGATVLPESVRPVK |
| Ga0187778_103462091 | 3300017961 | Tropical Peatland | EAELSAARRAFEEDPGVKGLRERFGATVLPDTVRPVK |
| Ga0187783_107726101 | 3300017970 | Tropical Peatland | QRRASEAELVAARRAFEEDPAVKGLRERFGATVLPDTVRPVK |
| Ga0187777_105508271 | 3300017974 | Tropical Peatland | AQRRASEEELAAARRAFEADPGVQGLRERFGATVLPESVRPLK |
| Ga0187815_103267091 | 3300018001 | Freshwater Sediment | AGERASQEELEAARRAFESDPAVQGFRERFGAAPLPETIRPVK |
| Ga0187770_100554216 | 3300018090 | Tropical Peatland | PALLARRASEAELAAAQRAFADDPGVRGLRERFGATVLSETVRPVK |
| Ga0206356_105085361 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | PAQAGERATQEEAEAARRAFESDPGVQGFRERFGATPLPETIRPLK |
| Ga0187768_11271502 | 3300020150 | Tropical Peatland | RATQQELTEARRAFEADPGVQGLRERFGATVLPDTVRPVK |
| Ga0210399_105381793 | 3300020581 | Soil | ELAAARRAFEADPGVQGLRERFGATVLPDSVRPVK |
| Ga0210396_113293611 | 3300021180 | Soil | ELSVARRAFEADPNVQGLRERFGATVLPDTVRPVK |
| Ga0210385_107504461 | 3300021402 | Soil | DEELASARRAFEDDAGVKGLRERFGATVLPDTVRPLK |
| Ga0210386_106851051 | 3300021406 | Soil | RASQQELEAARQAFETDPGVKGLRERFGATLLPNTIRPVK |
| Ga0213879_102450091 | 3300021439 | Bulk Soil | AQRASQQELAVARSAFEADPGVQGLRERFGATVLPDTVRPVK |
| Ga0187846_101886773 | 3300021476 | Biofilm | AHAAQRASQQELTQARRAFETDPGVQGLRERFGATVLPDTVRPVK |
| Ga0242669_11051402 | 3300022528 | Soil | AQRASQQELSSARRAFEADPGVQGLRERFGATVLPDTVRPLK |
| Ga0207693_101182844 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | AQRRASEAELAAARRAFEEDAGVKGLRERFGATVLPDTVRPVK |
| Ga0207694_104515673 | 3300025924 | Corn Rhizosphere | AEQRASQQELDNARQSFEADPGVQGLRERFGATLLPDTVRPVK |
| Ga0207664_103668564 | 3300025929 | Agricultural Soil | AQRRASDTELAQARQAFEEDAGVKGLRERFGATVLPDSVRPVK |
| Ga0207711_100847225 | 3300025941 | Switchgrass Rhizosphere | RASDTELAQARQAFEEDAGVKGLRERFGATVLPDSVRPVK |
| Ga0207698_107930901 | 3300026142 | Corn Rhizosphere | SSQEEIDSARRALEADPGVQGLRERFGATLLPDTVRPLKSQE |
| Ga0209057_10347056 | 3300026342 | Soil | VSEQELAAARRAFEADPGVQGLRERFGATVLPESVRPVK |
| Ga0207815_10487781 | 3300027014 | Tropical Forest Soil | SETELAGARRAFEEDAGVKGLRERFGATVLPDTVRPVK |
| Ga0209524_10152161 | 3300027521 | Forest Soil | EQELAAARRAFEADPGVQGLRERFGAAVLPDTVRPVK |
| Ga0209419_10770551 | 3300027537 | Forest Soil | RRASEQELAAARRAFEADPGVQGLRERFGATVLPDSVRPVK |
| Ga0208984_10084954 | 3300027546 | Forest Soil | RASEQELAAARRAFEADPGVQGLRERFGAAVLPDTVRPVK |
| Ga0209815_11465572 | 3300027714 | Marine | AEQRASLEDLDSARRAFESDPGVQGLKERFGATLLPETVRPVK |
| Ga0209693_105745812 | 3300027855 | Soil | DEELSVARRAFEEDAGVKGLRERFGATVLPDTVRPVK |
| Ga0209167_101135314 | 3300027867 | Surface Soil | SDADLAVARQAFQEDPGVRGLRERFGATVLPETVRPVK |
| Ga0209167_101987453 | 3300027867 | Surface Soil | ELTEVRRAFEADPGVQGLRERFGATVLPETVRPVK |
| Ga0209465_100561481 | 3300027874 | Tropical Forest Soil | PAQAQRRATEAELSVARRAFDEDAGVKGLRERFGAAVLPETVRPVK |
| Ga0209590_108148272 | 3300027882 | Vadose Zone Soil | RRARRVSEQELAAARRAFEADPGVQGLRERFGATVLTDSVRPVK |
| Ga0209380_103893041 | 3300027889 | Soil | QAQRRASEAELAAARLAFEEDPAVKGLRERFGATVLPDTVRPVK |
| Ga0209006_109896723 | 3300027908 | Forest Soil | ASMEDLDAARRAFESDPGVQGFRERFGATLLPDTVRPVK |
| Ga0209583_107267871 | 3300027910 | Watersheds | LARRAAEAEQAAAQRAFEEDPGVRGLRERFGATVLPETVRPVK |
| Ga0308309_101100864 | 3300028906 | Soil | RASDEELSVARRAFEEDAGVKGLRERFGATVLPDTVRPVK |
| Ga0311354_101459415 | 3300030618 | Palsa | QLASARESLESDPGVQALRERFGATLLPDSVRPIK |
| Ga0302310_101217681 | 3300030737 | Palsa | HASLAQLTAARESLESDPGVQALRERFGATLLTDTVRPIK |
| Ga0307499_102197811 | 3300031184 | Soil | QRAVVEEFDSARQALETDPAVRALRETFGATLLPDSVRPLK |
| Ga0307509_105509481 | 3300031507 | Ectomycorrhiza | MEDLDAARRAFESDPGVQGLKERFGATLLPETIRPVK |
| Ga0318534_100698274 | 3300031544 | Soil | PDHAAARRAFEEDAGVKGLRERFGATVLPETVRPVK |
| Ga0318573_100981451 | 3300031564 | Soil | ASEAELGAARRAFDEDAGVKGLRERFGAAVLPETVRPVK |
| Ga0310915_107044553 | 3300031573 | Soil | RRASEAELTAARRAFEEDPAVKGLRERFGATVLPETVRPVK |
| Ga0310686_1142853671 | 3300031708 | Soil | QRASQQELDVARQAFETDPGVKTLRERFGATLLPDTVRPIK |
| Ga0318496_104315561 | 3300031713 | Soil | QRRASEAELAAARRAFEEDAGVKGLRERFGATVLPETVRPVK |
| Ga0318493_101449551 | 3300031723 | Soil | SQRRASEAELAAARRAFEEDAGVKGLRERFGATVLPETVRPVK |
| Ga0306918_104994551 | 3300031744 | Soil | ASEAELTSARRAFDEDAGVKGLRERFGAAVLPETVRPVK |
| Ga0318521_105032451 | 3300031770 | Soil | QAQRRASEAELATARRAFDEDAGVKGLRERFGASVLPDTVRPLK |
| Ga0318552_102045513 | 3300031782 | Soil | APAAARRAFEEDAGVKGLRERFGATVLPETVRPVK |
| Ga0318503_100838201 | 3300031794 | Soil | AETPAQAQRRASEAELGAARRAFDEDAGVKGLRERFGAAVLPETVRPVK |
| Ga0318576_101052211 | 3300031796 | Soil | EAELGAARRAFDEDAGVKGLRERFGAAVLPETVRPVK |
| Ga0318576_101727161 | 3300031796 | Soil | QAQRRASEAELASARRAFEEDAGVKGLRERFGATVLPDTVRPVK |
| Ga0318523_100608754 | 3300031798 | Soil | AELSAARRAFDEDAGVKGLREHFGAAVLPETVRPVK |
| Ga0318497_100363491 | 3300031805 | Soil | VAALAAARRAFEEDAGVKGLRERFGATVLPETVRPVK |
| Ga0318497_104360093 | 3300031805 | Soil | AELASARRAFEEDAGVKGLRERFGATVLPDTVRPVK |
| Ga0318568_100866374 | 3300031819 | Soil | AQRRASEAELAAARRAFEEDAGVKGLRERFGATVLPETVRPVK |
| Ga0318544_104306171 | 3300031880 | Soil | AQRRASEAELSSARRAFDEDAGVKGLRDRFGAAVLPETVRPVK |
| Ga0318522_100545614 | 3300031894 | Soil | ASEAELTAARRAFDEDAGVKGLRERFGAAVLPETVRPVK |
| Ga0306923_102721254 | 3300031910 | Soil | APPPRRARAAAPAAARRAFEEDAGVKGLRERFGATVLPETVRPVK |
| Ga0310912_102618641 | 3300031941 | Soil | AQRRASEAELATARRAFEEDAGVKGLRERFGATVLPDTVRPVK |
| Ga0310910_107912861 | 3300031946 | Soil | KRASEAELATARRAFDEDAGVKGLRERFGAAVLPETVRPVK |
| Ga0307479_103906054 | 3300031962 | Hardwood Forest Soil | SEAELTAARRSFDEDAGVKGLRERFGAAVLPETVRPVK |
| Ga0307479_115529453 | 3300031962 | Hardwood Forest Soil | QRRASEAELAAARLAFEEDAGVKGLRERFGATVLPETVRPVK |
| Ga0318563_104208351 | 3300032009 | Soil | QAQRRAEEARLAKARQAFEADPGVQGLRERFGATVLPDTVRPLK |
| Ga0318563_107878502 | 3300032009 | Soil | AELTAARRAFDEDAGVKGLRERFGAAVLPETVRPVK |
| Ga0318569_102053661 | 3300032010 | Soil | AQRRASEAELATARRAFDEDAGVKGLRERFGASVLPDTVRPVK |
| Ga0318507_104765522 | 3300032025 | Soil | ELTSARRAFDEDAGVKGLRERFGAAVLPETVRPVK |
| Ga0318575_102107951 | 3300032055 | Soil | RASEAELATARRAFDEDAGVRGLRERFGATVLPETVRPVK |
| Ga0318513_103641423 | 3300032065 | Soil | RMHAARRAFEEDAGVKGLRERFGATVLPETVRPVK |
| Ga0318553_105506681 | 3300032068 | Soil | SEAELTAARRAFDEDAGVKGLRERFGAAVLPETVRPVK |
| Ga0307471_1004843444 | 3300032180 | Hardwood Forest Soil | LLARRLTEAELAAARRAFESDPGVQGLRERFGATVLPESVRPVK |
| Ga0307471_1038403521 | 3300032180 | Hardwood Forest Soil | QAQRRASEQDLAAARRAFDADPGVATLRERFGAAVLPDTVRPVK |
| Ga0306920_1017636561 | 3300032261 | Soil | ELESARRALEADPGVQGLRERFGATLLPETVRPVKS |
| Ga0335081_107878553 | 3300032892 | Soil | ASDEELAAARRAFEDDAGVKGLRERFGATVLPETVRPVK |
| Ga0335075_105861963 | 3300032896 | Soil | QEEIESARRAFEADPGVQGFRDRFGATPLAETIRPVK |
| Ga0335076_103922971 | 3300032955 | Soil | LEDRDTARRAFESDPGVQGLRDRFGATLLPETVRPVK |
| Ga0335077_103617601 | 3300033158 | Soil | GDAETPALIARRASEAELAAARRAFEDDPGVKGLRERFGASVLPETVRPVK |
| Ga0310914_112921583 | 3300033289 | Soil | ELAAARRAFEDDPAVKGLRERFGATVLPDSVRPVK |
| ⦗Top⦘ |