


| Basic Information | |
|---|---|
| Family ID | F096038 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MKKKKGNSVVWHIYHTILAIELALVVAIEFTELMLKL |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 57.14 % |
| % of genes near scaffold ends (potentially truncated) | 22.86 % |
| % of genes from short scaffolds (< 2000 bps) | 64.76 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.857 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (60.952 % of family members) |
| Environment Ontology (ENVO) | Unclassified (82.857 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.476 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.62% β-sheet: 0.00% Coil/Unstructured: 55.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF01381 | HTH_3 | 11.43 |
| PF12236 | Head-tail_con | 4.76 |
| PF04098 | Rad52_Rad22 | 3.81 |
| PF01726 | LexA_DNA_bind | 3.81 |
| PF08291 | Peptidase_M15_3 | 2.86 |
| PF12850 | Metallophos_2 | 0.95 |
| PF16778 | Phage_tail_APC | 0.95 |
| PF00004 | AAA | 0.95 |
| PF17212 | Tube | 0.95 |
| PF00959 | Phage_lysozyme | 0.95 |
| PF04233 | Phage_Mu_F | 0.95 |
| PF01832 | Glucosaminidase | 0.95 |
| PF02195 | ParBc | 0.95 |
| PF06114 | Peptidase_M78 | 0.95 |
| PF13443 | HTH_26 | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.86 % |
| All Organisms | root | All Organisms | 35.24 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 1.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10003358 | Not Available | 11939 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10014407 | Not Available | 3998 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10032471 | Not Available | 2426 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10034268 | Not Available | 2346 | Open in IMG/M |
| 3300001355|JGI20158J14315_10041708 | All Organisms → Viruses → Predicted Viral | 2029 | Open in IMG/M |
| 3300001450|JGI24006J15134_10001266 | Not Available | 14554 | Open in IMG/M |
| 3300001450|JGI24006J15134_10026653 | Not Available | 2586 | Open in IMG/M |
| 3300001450|JGI24006J15134_10134932 | Not Available | 831 | Open in IMG/M |
| 3300001450|JGI24006J15134_10149444 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 767 | Open in IMG/M |
| 3300001450|JGI24006J15134_10204669 | Not Available | 599 | Open in IMG/M |
| 3300001460|JGI24003J15210_10088536 | Not Available | 916 | Open in IMG/M |
| 3300001472|JGI24004J15324_10004649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5310 | Open in IMG/M |
| 3300001472|JGI24004J15324_10038046 | Not Available | 1508 | Open in IMG/M |
| 3300001472|JGI24004J15324_10038294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 1501 | Open in IMG/M |
| 3300001472|JGI24004J15324_10089620 | Not Available | 813 | Open in IMG/M |
| 3300001472|JGI24004J15324_10119255 | Not Available | 649 | Open in IMG/M |
| 3300001589|JGI24005J15628_10108138 | Not Available | 919 | Open in IMG/M |
| 3300001589|JGI24005J15628_10211501 | Not Available | 536 | Open in IMG/M |
| 3300001589|JGI24005J15628_10219917 | Not Available | 519 | Open in IMG/M |
| 3300001735|JGI24520J20079_1008465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 597 | Open in IMG/M |
| 3300002242|KVWGV2_10361124 | Not Available | 1264 | Open in IMG/M |
| 3300002242|KVWGV2_10731464 | Not Available | 1907 | Open in IMG/M |
| 3300004097|Ga0055584_101684395 | Not Available | 655 | Open in IMG/M |
| 3300005408|Ga0066848_10076075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 918 | Open in IMG/M |
| 3300005514|Ga0066866_10003660 | All Organisms → cellular organisms → Bacteria | 6401 | Open in IMG/M |
| 3300005514|Ga0066866_10263152 | Not Available | 594 | Open in IMG/M |
| 3300005514|Ga0066866_10330582 | Not Available | 517 | Open in IMG/M |
| 3300005523|Ga0066865_10010680 | Not Available | 2854 | Open in IMG/M |
| 3300005913|Ga0075108_10031901 | All Organisms → cellular organisms → Bacteria | 2022 | Open in IMG/M |
| 3300005931|Ga0075119_1125142 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300006029|Ga0075466_1017896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 2326 | Open in IMG/M |
| 3300006166|Ga0066836_10091629 | Not Available | 1755 | Open in IMG/M |
| 3300006166|Ga0066836_10273533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1010 | Open in IMG/M |
| 3300006191|Ga0075447_10033574 | Not Available | 1964 | Open in IMG/M |
| 3300006315|Ga0068487_1025461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Tistrella → Tistrella mobilis | 5622 | Open in IMG/M |
| 3300006735|Ga0098038_1143647 | Not Available | 798 | Open in IMG/M |
| 3300006737|Ga0098037_1055831 | Not Available | 1415 | Open in IMG/M |
| 3300006737|Ga0098037_1106692 | Not Available | 966 | Open in IMG/M |
| 3300006738|Ga0098035_1215078 | Not Available | 639 | Open in IMG/M |
| 3300006751|Ga0098040_1041046 | Not Available | 1456 | Open in IMG/M |
| 3300006753|Ga0098039_1063685 | All Organisms → Viruses | 1282 | Open in IMG/M |
| 3300006793|Ga0098055_1073440 | Not Available | 1352 | Open in IMG/M |
| 3300006923|Ga0098053_1015245 | Not Available | 1703 | Open in IMG/M |
| 3300006925|Ga0098050_1114491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 686 | Open in IMG/M |
| 3300006928|Ga0098041_1021746 | All Organisms → Viruses → Predicted Viral | 2095 | Open in IMG/M |
| 3300006929|Ga0098036_1076705 | Not Available | 1030 | Open in IMG/M |
| 3300007276|Ga0070747_1020456 | unclassified Hyphomonas → Hyphomonas sp. | 2700 | Open in IMG/M |
| 3300007514|Ga0105020_1039264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4184 | Open in IMG/M |
| 3300007555|Ga0102817_1104095 | Not Available | 624 | Open in IMG/M |
| 3300008012|Ga0075480_10024938 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 3653 | Open in IMG/M |
| 3300008217|Ga0114899_1045041 | Not Available | 1590 | Open in IMG/M |
| 3300009370|Ga0118716_1173305 | Not Available | 1048 | Open in IMG/M |
| 3300009414|Ga0114909_1015474 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 | 2593 | Open in IMG/M |
| 3300009441|Ga0115007_10262829 | Not Available | 1117 | Open in IMG/M |
| 3300009705|Ga0115000_10872443 | Not Available | 551 | Open in IMG/M |
| 3300009790|Ga0115012_10047568 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 | 2855 | Open in IMG/M |
| 3300010148|Ga0098043_1234444 | Not Available | 502 | Open in IMG/M |
| 3300010151|Ga0098061_1042032 | Not Available | 1802 | Open in IMG/M |
| 3300010153|Ga0098059_1129174 | Not Available | 999 | Open in IMG/M |
| 3300010153|Ga0098059_1369675 | Not Available | 543 | Open in IMG/M |
| 3300010883|Ga0133547_10265428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3592 | Open in IMG/M |
| 3300017708|Ga0181369_1007043 | Not Available | 2952 | Open in IMG/M |
| 3300017720|Ga0181383_1119457 | Not Available | 707 | Open in IMG/M |
| 3300017759|Ga0181414_1191584 | Not Available | 530 | Open in IMG/M |
| 3300017765|Ga0181413_1095861 | Not Available | 904 | Open in IMG/M |
| 3300020428|Ga0211521_10042335 | unclassified Hyphomonas → Hyphomonas sp. | 2402 | Open in IMG/M |
| 3300020438|Ga0211576_10109660 | Not Available | 1519 | Open in IMG/M |
| 3300020470|Ga0211543_10009712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5696 | Open in IMG/M |
| 3300020477|Ga0211585_10017165 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6191 | Open in IMG/M |
| 3300020478|Ga0211503_10053247 | Not Available | 2501 | Open in IMG/M |
| 3300021356|Ga0213858_10097601 | Not Available | 1434 | Open in IMG/M |
| 3300021791|Ga0226832_10319149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 637 | Open in IMG/M |
| 3300021958|Ga0222718_10000617 | All Organisms → cellular organisms → Bacteria | 36172 | Open in IMG/M |
| 3300022822|Ga0222646_114906 | Not Available | 945 | Open in IMG/M |
| 3300025045|Ga0207901_1012667 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1171 | Open in IMG/M |
| 3300025045|Ga0207901_1047468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 570 | Open in IMG/M |
| 3300025066|Ga0208012_1009984 | Not Available | 1710 | Open in IMG/M |
| 3300025086|Ga0208157_1087156 | Not Available | 770 | Open in IMG/M |
| 3300025096|Ga0208011_1000137 | Not Available | 32428 | Open in IMG/M |
| 3300025096|Ga0208011_1000765 | Not Available | 11940 | Open in IMG/M |
| 3300025099|Ga0208669_1117799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 540 | Open in IMG/M |
| 3300025118|Ga0208790_1146659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp. | 655 | Open in IMG/M |
| 3300025120|Ga0209535_1016382 | Not Available | 3897 | Open in IMG/M |
| 3300025120|Ga0209535_1021128 | All Organisms → Viruses | 3291 | Open in IMG/M |
| 3300025120|Ga0209535_1162195 | Not Available | 686 | Open in IMG/M |
| 3300025122|Ga0209434_1014402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 2816 | Open in IMG/M |
| 3300025137|Ga0209336_10022315 | All Organisms → Viruses → Predicted Viral | 2230 | Open in IMG/M |
| 3300025137|Ga0209336_10056147 | Not Available | 1206 | Open in IMG/M |
| 3300025137|Ga0209336_10063911 | Not Available | 1106 | Open in IMG/M |
| 3300025137|Ga0209336_10067882 | Not Available | 1063 | Open in IMG/M |
| 3300025137|Ga0209336_10139555 | Not Available | 649 | Open in IMG/M |
| 3300025137|Ga0209336_10178924 | Not Available | 538 | Open in IMG/M |
| 3300025138|Ga0209634_1047976 | Not Available | 2128 | Open in IMG/M |
| 3300025138|Ga0209634_1208140 | Not Available | 742 | Open in IMG/M |
| 3300025141|Ga0209756_1098182 | Not Available | 1270 | Open in IMG/M |
| 3300025168|Ga0209337_1016823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 | 4381 | Open in IMG/M |
| 3300025276|Ga0208814_1013489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 2863 | Open in IMG/M |
| 3300025425|Ga0208646_1022392 | All Organisms → Viruses → Predicted Viral | 1490 | Open in IMG/M |
| 3300025543|Ga0208303_1067577 | Not Available | 821 | Open in IMG/M |
| 3300025666|Ga0209601_1009581 | Not Available | 4356 | Open in IMG/M |
| 3300025821|Ga0209600_1163505 | Not Available | 610 | Open in IMG/M |
| 3300028192|Ga0257107_1148288 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 685 | Open in IMG/M |
| 3300031519|Ga0307488_10695403 | Not Available | 576 | Open in IMG/M |
| 3300031801|Ga0310121_10011047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7054 | Open in IMG/M |
| 3300034695|Ga0372840_082924 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 953 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 60.95% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 5.71% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.81% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.81% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.86% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.86% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 2.86% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.90% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.90% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.90% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.90% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.90% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.95% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.95% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.95% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.95% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.95% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.95% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.95% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001735 | Marine viral communities from the Pacific Ocean - LP-45 | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005408 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV72 | Environmental | Open in IMG/M |
| 3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006315 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300009370 | Combined Assembly of Gp0127930, Gp0127931 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020477 | Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022822 | Saline water microbial communities from Ace Lake, Antarctica - #293 | Environmental | Open in IMG/M |
| 3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
| 3300025066 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025425 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK8 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025666 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes) | Environmental | Open in IMG/M |
| 3300025821 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes) | Environmental | Open in IMG/M |
| 3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300034695 | Seawater microbial communities from the Northeast subarctic Pacific Ocean - P26_June_2012_500m | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_1000335833 | 3300000101 | Marine | MRKKRRDIVWHIYHTILAVELGAVAIIEFIELMYK* |
| DelMOSpr2010_100144072 | 3300000116 | Marine | MKKKKGNSVIWHIYHTILAIELALVVAIEFTELMLKL* |
| DelMOSpr2010_100324711 | 3300000116 | Marine | RSNIIMRKKRRDIVWHIYHTILAVELGAVAIIEFIELMYK* |
| DelMOSpr2010_100342685 | 3300000116 | Marine | MKSKSRGIVWHIYHTILAVELGAIVVIESIELIITLNQY* |
| JGI20158J14315_100417087 | 3300001355 | Pelagic Marine | MKSKSKDIVWHIYHTILAVELGAIVVIESIELIITLNQY* |
| JGI24006J15134_1000126620 | 3300001450 | Marine | MKAKSRDIVWHIYHTILAVELGAIVVIESIELIITLNQY* |
| JGI24006J15134_100266535 | 3300001450 | Marine | MKKKIKEQGIIWHIYHTILAIELGLVVIIEFIELMMNI* |
| JGI24006J15134_101349322 | 3300001450 | Marine | MKKKKGNSVVWHIYHTILAIELALVVAXEFTELMLXL* |
| JGI24006J15134_101494441 | 3300001450 | Marine | ILEYNMKSKSRGIVWHIYHTILAVELGAIVVIESIELIITLNQY* |
| JGI24006J15134_102046691 | 3300001450 | Marine | KKKGNSVVWHIYHTILAIELALVVAIEFTELMLQL* |
| JGI24003J15210_100885365 | 3300001460 | Marine | RNNIIMKKKRRDLVWHIYHTILALELGAVAIIEFIELMYK* |
| JGI24004J15324_100046495 | 3300001472 | Marine | MRKKRRDIVWHIYHTILAVEXGAVAIIEFIELMYK* |
| JGI24004J15324_100380465 | 3300001472 | Marine | MKKKRRDLVWHIYHTILALELGAVAIIEFIELMYK* |
| JGI24004J15324_100382946 | 3300001472 | Marine | KKGNSVVWHIYHTILAIELALVVAIEFTELMLKL* |
| JGI24004J15324_100896203 | 3300001472 | Marine | MMAFKFKKKNRRDLVWHIYHTILALELGAVAIIEFIELMYK* |
| JGI24004J15324_101192551 | 3300001472 | Marine | KKGNSVVWHIYHTILAIELALVVAIEFTELMLQL* |
| JGI24005J15628_101081382 | 3300001589 | Marine | MKAKSRGIVWHIYHTILAVELGAIVVIESIELIITLNQY* |
| JGI24005J15628_102115011 | 3300001589 | Marine | MKKKKGNSVVWHIYHTILAIELALVVAIEFTELMIQL* |
| JGI24005J15628_102199172 | 3300001589 | Marine | MKKKKSNSIVWHIYHTILAIELALVVAIEFTELMLQL* |
| JGI24520J20079_10084652 | 3300001735 | Marine | MRKKKSNGIVWHIYHAILVIELALIVIIEFIELMNNI* |
| KVWGV2_103611242 | 3300002242 | Marine Sediment | MKKKRRDIVWHIYHTILAVELGAVAIIXFIELMYK* |
| KVWGV2_107314642 | 3300002242 | Marine Sediment | MKKKSKNVVWHIYHTILAIELGLVVIIEFIELMMKI* |
| Ga0055584_1016843951 | 3300004097 | Pelagic Marine | KGLMKKKKGNSVVWHIYHTILAIELALVVAIEFTELMLKL* |
| Ga0066848_100760752 | 3300005408 | Marine | GNLVRKKKGNGIIWHIYHTILAIELGLVVIIEFIELMNNI* |
| Ga0066866_100036605 | 3300005514 | Marine | MRKKKGNGVIWHIYHTILAIELGLVVIIEFIELMKNI* |
| Ga0066866_102631521 | 3300005514 | Marine | MKKKNLKNGIVWHIYHTILAIELGIVATIEFIELMMNL* |
| Ga0066866_103305822 | 3300005514 | Marine | MKKRITIKSKGVVWHIYHSILAFELALIIAIEFTELMMNL* |
| Ga0066865_1001068011 | 3300005523 | Marine | MKDSSKKRSVVWHIYHTILAIELGIVATIEFIELMMTIN* |
| Ga0075108_100319014 | 3300005913 | Saline Lake | MKNKKGNSVVWHIYHTILAIELALVVAIEFTELMLQL* |
| Ga0075119_11251422 | 3300005931 | Saline Lake | MKKKKGNSVVWHIYHTILAIELALVVAIEFTELMLRL* |
| Ga0075466_10178966 | 3300006029 | Aqueous | MKKKKGNSVVWHIYHTILAIELALVVAIEFTELMLKL* |
| Ga0066836_100916293 | 3300006166 | Marine | MKKRITIKSKGVVWHIYHTILAFELALIVVIEFTELMMSL* |
| Ga0066836_102735332 | 3300006166 | Marine | MRKKKGNGVIWHVYHTILAIELGLVVIIEFIELMKNI* |
| Ga0075447_100335743 | 3300006191 | Marine | MKNKKGNSVVWHIYHTILAIELALVVAIEFTELMLKL* |
| Ga0068487_10254616 | 3300006315 | Marine | MKKKYSRGVVWHIYHTILAIELGIVALIEFIELMNNF* |
| Ga0098038_11436473 | 3300006735 | Marine | MKKKRRDIVWHIYHTILAIELGAVAIIEFIELMYK* |
| Ga0098037_10558313 | 3300006737 | Marine | MKKKRRDVVWHIYHTILAIELGAVAIIEFIELMYK* |
| Ga0098037_11066923 | 3300006737 | Marine | MRKKRRDVVWHIYHTILAIELGAVAIIEFIELMYK* |
| Ga0098035_12150781 | 3300006738 | Marine | MGSNMKKRITLKSKGVVWHVYHTILAFELALIVVIE |
| Ga0098040_10410461 | 3300006751 | Marine | SKSNETVGRSMKKKADKNLVWHIYHTILAIELALVVLIEFVELMYLI* |
| Ga0098039_10636851 | 3300006753 | Marine | LVRKKKGNGIIWHIYHTILAIELGLVVIIEFIELMNNI* |
| Ga0098055_10734401 | 3300006793 | Marine | KKRITLKSKGVVWHVYHTILAFELALIVVIEFTELMMSL* |
| Ga0098053_10152452 | 3300006923 | Marine | MKKRITIKSKGVVWHIYHSILAFELALIIAIEFTELMINI* |
| Ga0098050_11144912 | 3300006925 | Marine | MGSNMKKRITLKSKGVVWHIYHTILAFELALIVVIEFTELMMSL* |
| Ga0098041_10217469 | 3300006928 | Marine | YRSNNIMKKKRRDVVWHIYHTILAIELGAVAIIEFIELMYK* |
| Ga0098036_10767052 | 3300006929 | Marine | MKKRITIKSKGVVWHIYHSILAFELALIIAIEFTE |
| Ga0070747_10204565 | 3300007276 | Aqueous | MRKKRRDIVWHIYHTILAVELGAVAIIEFIELIYK* |
| Ga0105020_10392642 | 3300007514 | Marine | MRKKKGNGVIWHIYHTILAIELGLVVIIEFIELMNNF* |
| Ga0102817_11040952 | 3300007555 | Estuarine | MKKKRRDIVWHIYHTILAVELGAVAIIEFIELMYK* |
| Ga0075480_100249384 | 3300008012 | Aqueous | MKKSKRDVVWHIYHTILAIELAMVVVIQTISLVHHW* |
| Ga0114899_10450413 | 3300008217 | Deep Ocean | MKKKDDKNLVWHIYHTILAIELALVVLIEFVELMYLI* |
| Ga0118716_11733052 | 3300009370 | Marine | MKKRINLKSKGVVWHVYHTILAIELGLVVIIEFTELMIK* |
| Ga0114909_10154748 | 3300009414 | Deep Ocean | MKKKADKNLVWHIYHTILAIELALVVLIEFVELMYLI* |
| Ga0115007_102628292 | 3300009441 | Marine | MKNKKGNSVIWHIYHTILAIELALVVAIEFTELMLQL* |
| Ga0115000_108724432 | 3300009705 | Marine | MKKKKGNSVIWHIYHTILAIELALVVAIEFIELMLQL* |
| Ga0115012_100475687 | 3300009790 | Marine | MKKRITIKSKGVVWHIYHTILAFELALIVAIEFTELMMNI* |
| Ga0098043_12344443 | 3300010148 | Marine | SNNIMKKKRRDVVWHIYHTILAIELGAVAIIEFIELMYK* |
| Ga0098061_10420322 | 3300010151 | Marine | MKKRITLKSKGVVWHVYHTILAFELALIVVIEFTELLMSL* |
| Ga0098059_11291742 | 3300010153 | Marine | VRKKIKKHGVVWHIYHTILAIELALVVLIEFVELMYLI* |
| Ga0098059_13696751 | 3300010153 | Marine | MKKRITLKSKGVVWHVYHTILAFELALIVVIEFTELMMSL* |
| Ga0133547_102654284 | 3300010883 | Marine | MSKKKGNGIVWHIYHTILAIELGLVVIIEFIELMNNI* |
| Ga0181369_100704311 | 3300017708 | Marine | YRSNIIMRKKRRDVVWHIYHTILAIELGAVAIIEFIELMYK |
| Ga0181383_11194572 | 3300017720 | Seawater | MKKKRRDIVWHIYHTILAVELGVVAIIEFIELMYK |
| Ga0181414_11915842 | 3300017759 | Seawater | MKKKRRDVVWHIYHTILAVELGAVAIIEFIELMYK |
| Ga0181413_10958615 | 3300017765 | Seawater | RSDIIMKKKRRDIVWHIYHTILAVELGAVAIIEFIELMYK |
| Ga0211521_100423353 | 3300020428 | Marine | MKKKRRDIVWHLYHTILAVELGAVAIIEFIELMYKXDLNIKLEN |
| Ga0211576_101096602 | 3300020438 | Marine | MKKKKGNSVVWHIYHTILAIELALVVAIEFTELMLKL |
| Ga0211543_100097129 | 3300020470 | Marine | MKKKYSRGVVWHIYHTILAIELGIVALIEFIELMNNF |
| Ga0211585_100171652 | 3300020477 | Marine | MRKKKGNGVIWHIYHTILAIELGLVVIIEFIELMNNF |
| Ga0211503_100532473 | 3300020478 | Marine | MGSSMKKRINLKSKGVVWHIYHTILAIELGLVVIIEFTELMIK |
| Ga0213858_100976016 | 3300021356 | Seawater | MRKKRRDVVWHIYHTILAIELGAVAIIEFIELMYK |
| Ga0226832_103191491 | 3300021791 | Hydrothermal Vent Fluids | MRKKKGNGAIWHIYHTILAIELGLVVIIEFIELMNNI |
| Ga0222718_1000061744 | 3300021958 | Estuarine Water | MKKKDSRPLLWHIYHTILAIELAIIVAIELTELILTHF |
| Ga0222646_1149063 | 3300022822 | Saline Water | MKKKKGNSVVWHIYHTILAIELALVVAIEFTELMLQL |
| Ga0207901_10126672 | 3300025045 | Marine | VRKNNKNGIVWHIYHTILAIELALVVAIEFTELMMNL |
| Ga0207901_10474681 | 3300025045 | Marine | MRKKKGNGIVWHIYHTILAIELGLVVIIEFIELMNNI |
| Ga0208012_10099844 | 3300025066 | Marine | MKKRITIKSKGVVWHIYHTILAFELALIVVIEFTELMMSL |
| Ga0208157_10871561 | 3300025086 | Marine | MKKKRRDVVWHIYHTILAIELGAVAIIEFIELMYK |
| Ga0208011_100013740 | 3300025096 | Marine | MKKKNLKNGIVWHIYHTILAIELGIVATIEFIELMMNL |
| Ga0208011_100076518 | 3300025096 | Marine | MKKRITIKSKGVVWHIYHSILAFELALIIAIEFTELMMNL |
| Ga0208669_11177992 | 3300025099 | Marine | MRKKKGNGVIWHIYHTILAIELGLVVIIEFIELMKNI |
| Ga0208790_11466592 | 3300025118 | Marine | PWYCYKYRGNLMRKKKGNGVIWHIYHTILAIELGLVVIIEFIELMKNI |
| Ga0209535_10163829 | 3300025120 | Marine | MKKKKGNSVVWHIYHTILAIELALVVAIEFTELMIQL |
| Ga0209535_102112812 | 3300025120 | Marine | MRKKRRDIVWHIYHTILAVELGAVAIIEFIELMYK |
| Ga0209535_11621953 | 3300025120 | Marine | MKKKRRDIVWHIYHTILAVELGAVAIIEFIELMYK |
| Ga0209434_10144024 | 3300025122 | Marine | MRKKKGNGIIWHIYHTILAIELGLVVIIEFIELMNNI |
| Ga0209336_100223154 | 3300025137 | Marine | MKAKSRDIVWHIYHTILAVELGAIVVIESIELIITLNQY |
| Ga0209336_100561474 | 3300025137 | Marine | MKKKRRDLVWHIYHTILALELGAVAIIEFIELMYKXD |
| Ga0209336_100639113 | 3300025137 | Marine | MKSKSRGIVWHIYHTILAVELGAIVVIESIELIITLNQY |
| Ga0209336_100678825 | 3300025137 | Marine | KKKGNSVVWHIYHTILAIELALVVAIEFTELMLKL |
| Ga0209336_101395553 | 3300025137 | Marine | KKKGNSVVWHIYHTILAIELALVVAIEFTELMLQL |
| Ga0209336_101789242 | 3300025137 | Marine | KKKKGNSVVWHIYHTILAIELALVVAIEFTELMLKL |
| Ga0209634_10479765 | 3300025138 | Marine | MKKKRRDLVWHIYHTILALELGAVAIIEFIELMYK |
| Ga0209634_12081402 | 3300025138 | Marine | MKKKKSNSIVWHIYHTILAIELALVVAIEFTELMLQL |
| Ga0209756_10981823 | 3300025141 | Marine | MKKKADKNLVWHIYHTILAIELALVVLIEFVELMYLI |
| Ga0209337_101682315 | 3300025168 | Marine | MKKKIKEQGIIWHIYHTILAIELGLVVIIEFIELMMNI |
| Ga0208814_10134896 | 3300025276 | Deep Ocean | MKNKKGNSVIWHIYHTILAIELALVVAIEFTELMLKL |
| Ga0208646_10223922 | 3300025425 | Saline Lake | MKNKKGNSVVWHIYHTILAIELALVVAIEFTELMLQL |
| Ga0208303_10675772 | 3300025543 | Aqueous | MKKKKGNSVIWHIYHTILAIELALVVAIEFTELMLKL |
| Ga0209601_10095819 | 3300025666 | Pelagic Marine | KGLMKNKKGNSVVWHIYHTILAIELALVVAIEFTELMLQL |
| Ga0209600_11635052 | 3300025821 | Pelagic Marine | MKNKKGNSVVWHIYHTILAIELALVVAIEFTELMLKL |
| Ga0257107_11482881 | 3300028192 | Marine | VRKKIKKNGIVWHIYHTILAIELALVVAIEFTELMMSL |
| Ga0307488_106954031 | 3300031519 | Sackhole Brine | MKAKSRGIVWHIYHTILAVELGAIVVIESIELIITLNQY |
| Ga0310121_100110474 | 3300031801 | Marine | MSKKKGNGIVWHIYHTILAIELALVVIIEFIELMNNI |
| Ga0372840_082924_289_417 | 3300034695 | Seawater | MGSCVRKKIKKNGIVWHIYHTILAIELALVVAIEFTELMMSL |
| ⦗Top⦘ |